PDB entry 1vi4

View 1vi4 on RCSB PDB site
Description: Crystal structure of Regulator of ribonuclease activity A protein 1
Class: Structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulator of ribonuclease activity A protein 1
    Species: Vibrio cholerae [TaxId:666]
    Gene: RRAA1, VC2366
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KPK1 (3-163)
      • modified residue (3)
      • modified residue (76)
      • modified residue (104)
      • modified residue (107)
      • modified residue (135)
      • modified residue (155)
      • cloning artifact (164)
    Domains in SCOPe 2.07: d1vi4a1, d1vi4a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vi4A (A:)
    mslmrditpdlcdkyesqvtllnlplqnfgqrsafwgeivtvrcyhdnskvrdvlsqngk
    gkvlvvdghgschkalmgdqlailaikndwegviiygavrdvvamsemdlgikalgtspf
    ktekrgagqvnvtltmqnqivepgdylyadwngilmsetaldvaeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi4A (A:)
    mrditpdlcdkyesqvtllnlplqnfgqrsafwgeivtvrcyhdnskvrdvlsqngkgkv
    lvvdghgschkalmgdqlailaikndwegviiygavrdvvamsemdlgikalgtspfkte
    krgagqvnvtltmqnqivepgdylyadwngilmsetaldvae