PDB entry 1vi3

View 1vi3 on RCSB PDB site
Description: crystal structure of an hypothetical protein
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.192
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1vi3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vi3A (A:)
    mslklisndlrdgdklphrhvfngmgydgdnisphlawddvpagtksfvvtcydpdaptg
    sgwwhwvvvnlpadtrvlpqgfgsglvampdgvlqtrtdfgktgydgaappkgethryif
    tvhaldieridvdegasgamvgfnvhfhslasasitamfseggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi3A (A:)
    slklisndlrdgdklphrhvfngmgydgdnisphlawddvpagtksfvvtcydpdaptgs
    gwwhwvvvnlpadtrvlpqgfgsglvampdgvlqtrtdfgktgydgaappkgethryift
    vhaldieridvdegasgamvgfnvhfhslasasitamfse