PDB entry 1vi3

View 1vi3 on RCSB PDB site
Description: Crystal structure of an hypothetical protein
Class: Structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein ybhB
    Species: Escherichia coli [TaxId:562]
    Gene: YBHB, B0773
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12994 (3-159)
      • cloning artifact (1-2)
      • modified residue (24)
      • modified residue (88)
      • modified residue (139)
      • modified residue (157)
      • cloning artifact (160)
    Domains in SCOPe 2.07: d1vi3a1, d1vi3a2, d1vi3a3
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vi3A (A:)
    mslklisndlrdgdklphrhvfngmgydgdnisphlawddvpagtksfvvtcydpdaptg
    sgwwhwvvvnlpadtrvlpqgfgsglvampdgvlqtrtdfgktgydgaappkgethryif
    tvhaldieridvdegasgamvgfnvhfhslasasitamfseggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi3A (A:)
    slklisndlrdgdklphrhvfngmgydgdnisphlawddvpagtksfvvtcydpdaptgs
    gwwhwvvvnlpadtrvlpqgfgsglvampdgvlqtrtdfgktgydgaappkgethryift
    vhaldieridvdegasgamvgfnvhfhslasasitamfse