PDB entry 1vi1

View 1vi1 on RCSB PDB site
Description: Crystal structure of a fatty acid/phospholipid synthesis protein
Class: Structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.285
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid/phospholipid synthesis protein plsX
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PLSX, BSU15890
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71018 (3-334)
      • cloning artifact (1-2)
      • modified residue (9)
      • modified residue (81)
      • modified residue (84)
      • modified residue (106)
      • modified residue (158)
      • modified residue (246-247)
      • modified residue (251)
      • modified residue (271)
      • modified residue (273)
      • modified residue (275)
      • modified residue (306)
      • modified residue (314)
    Domains in SCOPe 2.07: d1vi1a1, d1vi1a2
  • Chain 'B':
    Compound: Fatty acid/phospholipid synthesis protein plsX
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PLSX, BSU15890
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71018 (3-End)
      • cloning artifact (1-2)
      • modified residue (9)
      • modified residue (81)
      • modified residue (84)
      • modified residue (106)
      • modified residue (158)
      • modified residue (246-247)
      • modified residue (251)
      • modified residue (271)
      • modified residue (273)
      • modified residue (275)
      • modified residue (306)
      • modified residue (314)
    Domains in SCOPe 2.07: d1vi1b1, d1vi1b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vi1A (A:)
    mslriavdamggdhapkavidgvikgieafddlhitlvgdkttieshltttsdritvlha
    devieptdepvravrrkknssmvlmaqevaenradacisagntgalmtaglfivgrikgi
    drpalaptlptvsgdgfllldvganvdakpehlvqyaimgsvysqqvrgvtsprvgllnv
    gtedkkgneltkqtfqilketaninfignveardllddvadvvvtdgftgnvtlktlegs
    alsifkmmrdvmtstltsklaaavlkpklkemkmkmeysnyggaslfglkapvikahgss
    dsnavfrairqaremvsqnvaaliqeevkeektdeeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi1A (A:)
    slriavdamggdhapkavidgvikgieafddlhitlvgdkttieshltttsdritvlhad
    evieptdepvravrrkknssmvlmaqevaenradacisagntgalmtaglfivgrikgid
    rpalaptlptvsgdgfllldvganvdakpehlvqyaimgsvysqqvrgvtsprvgllnvg
    tedkkgneltkqtfqilketaninfignveardllddvadvvvtdgftgnvtlktlegsa
    lsifkmmrdvmtstlvlkpklkemkmkmeysnyggaslfglkapvikahgssdsnavfra
    irqaremvsqnvaaliqeevkeektde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vi1B (B:)
    mslriavdamggdhapkavidgvikgieafddlhitlvgdkttieshltttsdritvlha
    devieptdepvravrrkknssmvlmaqevaenradacisagntgalmtaglfivgrikgi
    drpalaptlptvsgdgfllldvganvdakpehlvqyaimgsvysqqvrgvtsprvgllnv
    gtedkkgneltkqtfqilketaninfignveardllddvadvvvtdgftgnvtlktlegs
    alsifkmmrdvmtstltsklaaavlkpklkemkmkmeysnyggaslfglkapvikahgss
    dsnavfrairqaremvsqnvaaliqeevkeektdeeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi1B (B:)
    slriavdamggdhapkavidgvikgieafddlhitlvgdkttieshltttsdritvlhad
    evieptdepvravrrkknssmvlmaqevaenradacisagntgalmtaglfivgrikgid
    rpalaptlptvsgdgfllldvganvdakpehlvqyaimgsvysqqvrgvtsprvgllnvg
    tedkkgneltkqtfqilketaninfignveardllddvadvvvtdgftgnvtlktlegsa
    lsifkmmrdvmtstltspklkemkmkmeysnyggaslfglkapvikahgssdsnavfrai
    rqaremvsqnvaaliqeevke