PDB entry 1vi0

View 1vi0 on RCSB PDB site
Description: crystal structure of a transcriptional regulator
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOP 1.71 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.231
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vi0A (A:)
    mslkqkrpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislf
    kekmgqfiermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqk
    ineilkgylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlva
    lsnsvlellvsgihnkeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi0A (A:)
    pkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfkekmgqf
    iermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilkg
    ylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvle
    llvsgihnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vi0B (B:)
    mslkqkrpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislf
    kekmgqfiermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqk
    ineilkgylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlva
    lsnsvlellvsgihnkeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi0B (B:)
    pkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfkekmgqf
    iermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilkg
    ylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvle
    llvsgihn