PDB entry 1vi0

View 1vi0 on RCSB PDB site
Description: Crystal structure of a transcriptional regulator
Class: transcription
Keywords: structural genomics, TRANSCRIPTION
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.6500000000000001 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yerO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P94548 (Start-195)
      • modified residue (10)
      • modified residue (63)
      • modified residue (70)
      • modified residue (156)
      • modified residue (170)
    Domains in SCOPe 2.08: d1vi0a1, d1vi0a2
  • Chain 'B':
    Compound: Transcriptional regulator
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yerO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P94548
      • modified residue (10)
      • modified residue (63)
      • modified residue (70)
      • modified residue (156)
      • modified residue (170)
    Domains in SCOPe 2.08: d1vi0b1, d1vi0b2
  • Heterogens: DCC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vi0A (A:)
    mslkqkrpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislf
    kekmgqfiermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqk
    ineilkgylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlva
    lsnsvlellvsgihnkeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi0A (A:)
    pkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfkekmgqf
    iermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilkg
    ylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvle
    llvsgihnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vi0B (B:)
    mslkqkrpkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislf
    kekmgqfiermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqk
    ineilkgylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlva
    lsnsvlellvsgihnkeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi0B (B:)
    pkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfkekmgqf
    iermeedikekatakeklalviskhfsllagdhnlaivtqlelrqsnlelrqkineilkg
    ylnildgiltegiqsgeikegldvrlarqmifgtidetvttwvmndqkydlvalsnsvle
    llvsgihn