PDB entry 1vhz

View 1vhz on RCSB PDB site
Description: Crystal structure of ADP compounds hydrolase
Class: hydrolase
Keywords: structural genomics
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOP 1.75 freeze date was dated 2005-08-30, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.182
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP compounds hydrolase nudE
    Species: Escherichia coli
    Gene: NUDE, B3397
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45799 (3-End)
      • cloning artifact (1-2)
    Domains in SCOP 1.75: d1vhza_
  • Chain 'B':
    Compound: ADP compounds hydrolase nudE
    Species: Escherichia coli
    Gene: NUDE, B3397
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1vhzb_
  • Heterogens: APR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhzA (A:)
    mslskslqkptilnvetvarsrlftvesvdlefsngvrrvyermrptnreavmivpivdd
    hlilireyavgtesyelgfskglidpgesvyeaanrelkeevgfgandltflkklsmaps
    yfsskmnivvaqdlypeslegdepeplpqvrwplahmmdlledpdfnearnvsalflvre
    wlkgqgrveggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhzA (A:)
    slskslqkptilnvetvarsrlftvesvdlefsngvrrvyermrptnreavmivpivddh
    lilireyavgtesyelgfskglidpgesvyeaanrelkeevgfgandltflkklsmapsy
    fsskmnivvaqdlypeslegdepeplpqvrwplahmmdlledpdfnearnvsalflvrew
    lkgqgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vhzB (B:)
    mslskslqkptilnvetvarsrlftvesvdlefsngvrrvyermrptnreavmivpivdd
    hlilireyavgtesyelgfskglidpgesvyeaanrelkeevgfgandltflkklsmaps
    yfsskmnivvaqdlypeslegdepeplpqvrwplahmmdlledpdfnearnvsalflvre
    wlkgqgrveggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhzB (B:)
    skslqkptilnvetvarsrlftvesvdlefsngvrrvyermrptnreavmivpivddhli
    lireyavgtesyelgfskglidpgesvyeaanrelkeevgfgandltflkklsmapsyfs
    skmnivvaqdlypeslegdepeplpqvrwplahmmdlledpdfnearnvsalflvrewlk
    gqgrv