PDB entry 1vhy

View 1vhy on RCSB PDB site
Description: Crystal structure of Haemophilus influenzae protein HI0303, Pfam DUF558
Class: Structural genomics, unknown function
Keywords: PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, Structural genomics, unknown function
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein HI0303
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI0303
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44627 (Start-246)
      • modified residue (35)
      • modified residue (93)
      • modified residue (125)
      • modified residue (155)
      • cloning artifact (247-248)
    Domains in SCOPe 2.07: d1vhya1, d1vhya2, d1vhya3
  • Chain 'B':
    Compound: Hypothetical protein HI0303
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI0303
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44627 (Start-246)
      • modified residue (35)
      • modified residue (93)
      • modified residue (125)
      • modified residue (155)
      • cloning artifact (247-248)
    Domains in SCOPe 2.07: d1vhyb1, d1vhyb2, d1vhyb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhyA (A:)
    mslripriyhpislenqtqcylsedaanhvarvlrmtegeqlelfdgsnhiypakiiesn
    kksvkveilgreladkeshlkihlgqvisrgermeftiqksvelgvnvitplwsercgvk
    ldaermdkkiqqwqkiaiaaceqcgrnivpeirplmklqdwcaendgalklnlhprahys
    iktlptipaggvrlligsegglsaqeiaqteqqgfteillgkrvlrtetaslaaisalqi
    cfgdlgeeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhyA (A:)
    ipriyhpislenqtqcylsedaanhvarvlrmtegeqlelfdgsnhiypakiiesnkksv
    kveilgreladkeshlkihlgqvirmeftiqksvelgvnvitplwsercgvkldaermdk
    kiqqwqkiaiaaceqcgrnivpeirplmklqdwcaendgalklnlhprahysiktlptip
    aggvrlligsegglsaqeiaqteqqgfteillgkrvlrtetaslaaisalqicfgdlgee
    g
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vhyB (B:)
    mslripriyhpislenqtqcylsedaanhvarvlrmtegeqlelfdgsnhiypakiiesn
    kksvkveilgreladkeshlkihlgqvisrgermeftiqksvelgvnvitplwsercgvk
    ldaermdkkiqqwqkiaiaaceqcgrnivpeirplmklqdwcaendgalklnlhprahys
    iktlptipaggvrlligsegglsaqeiaqteqqgfteillgkrvlrtetaslaaisalqi
    cfgdlgeeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhyB (B:)
    ipriyhpislenqtqcylsedaanhvarvlrmtegeqlelfdgsnhiypakiivkveilg
    reladkeshlkihlgqvisrrmeftiqksvelgvnvitplwsercgvkldaermdkkiqq
    wqkiaiaaceqcgrnivpeirplmklqdwcaendgalklnlhprahysiktlptipaggv
    rlligsegglsaqeiaqteqqgfteillgkrvlrtetaslaaisalqicfgdlgeeg