PDB entry 1vhw

View 1vhw on RCSB PDB site
Description: crystal structure of purine nucleoside phosphorylase with adenosine
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.162
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1vhwa_
  • Chain 'B':
    Domains in SCOP 1.67: d1vhwb_
  • Chain 'C':
    Domains in SCOP 1.67: d1vhwc_
  • Chain 'D':
    Domains in SCOP 1.67: d1vhwd_
  • Chain 'E':
    Domains in SCOP 1.67: d1vhwe_
  • Chain 'F':
    Domains in SCOP 1.67: d1vhwf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhwA (A:)
    mslatphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrri
    svmghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnr
    irfkdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivg
    vemeaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq
    agyeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhwA (A:)
    atphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrrisvm
    ghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirf
    kdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgvem
    eaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vhwB (B:)
    mslatphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrri
    svmghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnr
    irfkdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivg
    vemeaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq
    agyeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhwB (B:)
    atphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrrisvm
    ghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirf
    kdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgvem
    eaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vhwC (C:)
    mslatphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrri
    svmghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnr
    irfkdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivg
    vemeaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq
    agyeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhwC (C:)
    atphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrrisvm
    ghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirf
    kdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgvem
    eaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vhwD (D:)
    mslatphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrri
    svmghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnr
    irfkdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivg
    vemeaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq
    agyeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhwD (D:)
    atphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrrisvm
    ghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirf
    kdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgvem
    eaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vhwE (E:)
    mslatphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrri
    svmghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnr
    irfkdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivg
    vemeaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq
    agyeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhwE (E:)
    tphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrrisvmg
    hgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirfk
    dhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgveme
    aagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vhwF (F:)
    mslatphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrri
    svmghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnr
    irfkdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivg
    vemeaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq
    agyeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhwF (F:)
    atphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrrisvm
    ghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirf
    kdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgvem
    eaagiygvaaeygakalaictvsdhiktgeqterqntfnemieialdsvligdq