PDB entry 1vhv

View 1vhv on RCSB PDB site
Description: Crystal structure of diphthine synthase
Class: transferase
Keywords: structural genomics, TRANSFERASE
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diphthine synthase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: DPHB, AF0381
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29866 (14-End)
      • cloning artifact (12-13)
      • modified residue (57)
      • modified residue (98)
      • modified residue (179)
      • modified residue (195)
      • modified residue (233)
      • modified residue (243)
    Domains in SCOPe 2.08: d1vhva1, d1vhva2
  • Chain 'B':
    Compound: diphthine synthase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: DPHB, AF0381
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29866 (14-263)
      • cloning artifact (12-13)
      • modified residue (57)
      • modified residue (98)
      • modified residue (179)
      • modified residue (195)
      • modified residue (233)
      • modified residue (243)
    Domains in SCOPe 2.08: d1vhvb1, d1vhvb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhvA (A:)
    mghhhhhhgghmslltfvglglwdvkdisvkgleavreadevyveyytskllssieemee
    ffgkrvvelersdleensfrlieraksksvvllvpgdpmvatthsaikleaerkgvktri
    ihgasistavcgltglhnyrfgksatvswhrsqtpvnvikanrsidahtllfldlhpepm
    tighavenliaedaqmkdlyavgiaragsgeevvkcdrlenlkkidfgkplhvmvvlakt
    lhfmefeclrefadapaelerlvaeggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhvA (A:)
    slltfvglglwdvkdisvkgleavreadevyveyytskllssieemeeffgkrvvelers
    dleensfrlieraksksvvllvpgdpmvatthsaikleaerkgvktriihgasistavcg
    ltglhnyrfgksatvswhrsqtpvnvikanrsidahtllfldlhpepmtighavenliae
    daqmkdlyavgiaragsgeevvkcdrlenlkkidfgkplhvmvvlaktlhfmefeclref
    adapaelerlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vhvB (B:)
    mghhhhhhgghmslltfvglglwdvkdisvkgleavreadevyveyytskllssieemee
    ffgkrvvelersdleensfrlieraksksvvllvpgdpmvatthsaikleaerkgvktri
    ihgasistavcgltglhnyrfgksatvswhrsqtpvnvikanrsidahtllfldlhpepm
    tighavenliaedaqmkdlyavgiaragsgeevvkcdrlenlkkidfgkplhvmvvlakt
    lhfmefeclrefadapaelerlvaeggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhvB (B:)
    slltfvglglwdvkdisvkgleavreadevyveyytskllssieemeeffgkrvvelers
    dleensfrlieraksksvvllvpgdpmvatthsaikleaerkgvktriihgasistavcg
    ltglhnyrfgksatvswhrsqtpvnvikanrsidahtllfldlhpepmtighavenliae
    daqmkdlyavgiaragsgeevvkcdrlenlkkidfgkplhvmvvlaktlhfmefeclref
    adapaelerlva