PDB entry 1vhu

View 1vhu on RCSB PDB site
Description: Crystal structure of a putative phosphoesterase
Class: Structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein af1521
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF1521
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28751 (Start-200)
      • modified residue (9)
      • modified residue (74)
      • modified residue (94)
      • modified residue (115)
      • modified residue (138)
    Domains in SCOPe 2.07: d1vhua_
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhuA (A:)
    mslerrtlimevlfeakvgditlklaqgditqypakaivnaankrlehgggvayaiakac
    agdaglyteiskkamreqfgrdyidhgevvvtpamnleergikyvfhtvgpicsgmwsee
    lkeklykaflgplekaeemgvesiafpavsagiygcdlekvvetfleavknfkgsavkev
    alviydrksaevalkvfersleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhuA (A:)
    mevlfeakvgditlklaqgditqypakaivnaankrlehgggvayaiakacagdaglyte
    iskkamreqfgrdyidhgevvvtpamnleergikyvfhtvgpicsgmwseelkeklykaf
    lgplekaeemgvesiafpavsagiygcdlekvvetfleavknfkgsavkevalviydrks
    aevalkvfersl