PDB entry 1vht

View 1vht on RCSB PDB site
Description: Crystal structure of dephospho-coA kinase with bis(adenosine)-5'-triphosphate
Class: transferase
Keywords: structural genomics, Transferase
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dephospho-coa kinase
    Species: Escherichia coli [TaxId:562]
    Gene: COAE, B0103, Z0113, ECS0107
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6I9 (3-207)
      • cloning artifact (1-2)
      • cloning artifact (208)
    Domains in SCOPe 2.07: d1vhta1, d1vhta2, d1vhta3
  • Chain 'B':
    Compound: dephospho-coa kinase
    Species: Escherichia coli [TaxId:562]
    Gene: COAE, B0103, Z0113, ECS0107
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6I9 (3-207)
      • cloning artifact (1-2)
      • cloning artifact (208)
    Domains in SCOPe 2.07: d1vhtb1, d1vhtb2, d1vhtb3
  • Chain 'C':
    Compound: dephospho-coa kinase
    Species: Escherichia coli [TaxId:562]
    Gene: COAE, B0103, Z0113, ECS0107
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6I9 (3-207)
      • cloning artifact (1-2)
      • cloning artifact (208)
    Domains in SCOPe 2.07: d1vhtc1, d1vhtc2, d1vhtc3
  • Heterogens: ACT, BA3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhtA (A:)
    mslryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganm
    iaadgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllven
    slykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnnga
    pdaiasdvarlhahylqlasqfvsqekpeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhtA (A:)
    slryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmi
    aadgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvens
    lykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngap
    daiasdvarlhahylqlasqfvsqekpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vhtB (B:)
    mslryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganm
    iaadgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllven
    slykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnnga
    pdaiasdvarlhahylqlasqfvsqekpeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhtB (B:)
    slryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmi
    aadgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvens
    lykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngap
    daiasdvarlhahylqlasqfvsqekpe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vhtC (C:)
    mslryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganm
    iaadgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllven
    slykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnnga
    pdaiasdvarlhahylqlasqfvsqekpeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhtC (C:)
    slryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhanmiaa
    dgtlwlnallhpliqqetqhqiqqatspyvlwvvpllvenslykkanrvlvvdvspetql
    krtmqrddvtrehveqilaaqatrearlavaddvidnngapdaiasdvarlhahylqlas
    qfvsqekpe