PDB entry 1vhs

View 1vhs on RCSB PDB site
Description: Crystal structure of a putative phosphinothricin N-acetyltransferase
Class: Structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.238
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: similar to phosphinothricin acetyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ywnH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71043 (3-164)
      • cloning artifact (1-2)
      • modified residue (27)
      • modified residue (41)
      • modified residue (118)
      • modified residue (149)
      • cloning artifact (165)
    Domains in SCOPe 2.05: d1vhsa_
  • Chain 'B':
    Compound: similar to phosphinothricin acetyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ywnH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71043 (3-164)
      • cloning artifact (1-2)
      • modified residue (41)
      • modified residue (118)
      • modified residue (149)
      • cloning artifact (165)
    Domains in SCOPe 2.05: d1vhsb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhsA (A:)
    msltlrlaehrdleavvaiynstiasrmvtadtepvtpedrmewfsghtesrplyvaede
    ngnvaawisfetfygrpaynktaevsiyideacrgkgvgsyllqealriapnlgirslma
    fifghnkpslklfekhgfaewglfpgiaemdgkrydlkilgrelseggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhsA (A:)
    sltlrlaehrdleavvaiynstiasrmvtadtepvtpedrmewfsghtesrplyvaeden
    gnvaawisfetfygrpaynktaevsiyideacrgkgvgsyllqealriapnlgirslmaf
    ifghnkpslklfekhgfaewglfpgiaemdgkrydlkilgrelse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vhsB (B:)
    msltlrlaehrdleavvaiynstiasrmvtadtepvtpedrmewfsghtesrplyvaede
    ngnvaawisfetfygrpaynktaevsiyideacrgkgvgsyllqealriapnlgirslma
    fifghnkpslklfekhgfaewglfpgiaemdgkrydlkilgrelseggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhsB (B:)
    sltlrlaehrdleavvaiynstiasepvtpedrmewfsghtesrplyvaedengnvaawi
    sfetfygrpaynktaevsiyideacrgkgvgsyllqealriapnlgirslmafifghnkp
    slklfekhgfaewglfpgiaemdgkrydlkilgrelse