PDB entry 1vhr

View 1vhr on RCSB PDB site
Description: human vh1-related dual-specificity phosphatase
Deposited on 1996-02-20, released 1996-06-20
The last revision prior to the SCOP 1.55 freeze date was dated 1996-06-20, with a file datestamp of 1996-06-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.176
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1vhra_
  • Chain 'B':
    Domains in SCOP 1.55: d1vhrb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vhrA (A:)
    svqdlndllsdgsgcyslpsqpcnevtpriyvgnasvaqdipklqklgithvlnaaegrs
    fmhvntnanfykdsgitylgikandtqefnlsayferaadfidqalaqkngrvlvhcreg
    ysrsptlviaylmmrqkmdvksalsivrqnreigpndgflaqlcqlndrlakegklkp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vhrB (B:)
    svqdlndllsdgsgcyslpsqpcnevtpriyvgnasvaqdipklqklgithvlnaaegrs
    fmhvntnanfykdsgitylgikandtqefnlsayferaadfidqalaqkngrvlvhcreg
    ysrsptlviaylmmrqkmdvksalsivrqnreigpndgflaqlcqlndrlakegklkp