PDB entry 1vhq

View 1vhq on RCSB PDB site
Description: Crystal structure of enhancing lycopene biosynthesis protein 2
Class: Structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enhancing lycopene biosynthesis protein 2
    Species: Escherichia coli [TaxId:562]
    Gene: ELBB, ELB2, B3209, SF3249, S3467
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABU5 (Start-221)
      • modified residue (5)
      • modified residue (61)
      • modified residue (128)
      • modified residue (138-139)
      • modified residue (144)
      • modified residue (170)
      • modified residue (197)
    Domains in SCOPe 2.07: d1vhqa_
  • Chain 'B':
    Compound: Enhancing lycopene biosynthesis protein 2
    Species: Escherichia coli [TaxId:562]
    Gene: ELBB, ELB2, B3209, SF3249, S3467
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABU5
      • modified residue (5)
      • modified residue (61)
      • modified residue (128)
      • modified residue (138-139)
      • modified residue (144)
      • modified residue (170)
      • modified residue (197)
    Domains in SCOPe 2.07: d1vhqb_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhqA (A:)
    mslitmkkigvilsgcgvydgseiheavltllaisrsgaqavcfapdkqqvdvinhltge
    amtetrnvlieaaritrgeirplaqadaaeldalivpggfgaaknlsnfaslgsectvdr
    elkalaqamhqagkplgfmciapamlpkifdfplrltigtdidtaevleemgaehvpcpv
    ddivvdednkivttpaymlaqniaeaasgidklvsrvlvlaeeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhqA (A:)
    mkkigvilsgcgvydgseiheavltllaisrsgaqavcfapdkqqvdvinhltgeamtet
    rnvlieaaritrgeirplaqadaaeldalivpggfgaaknlsnfaslgsectvdrelkal
    aqamhqagkplgfmciapamlpkifdfplrltigtdidtaevleemgaehvpcpvddivv
    dednkivttpaymlaqniaeaasgidklvsrvlvlae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vhqB (B:)
    mslitmkkigvilsgcgvydgseiheavltllaisrsgaqavcfapdkqqvdvinhltge
    amtetrnvlieaaritrgeirplaqadaaeldalivpggfgaaknlsnfaslgsectvdr
    elkalaqamhqagkplgfmciapamlpkifdfplrltigtdidtaevleemgaehvpcpv
    ddivvdednkivttpaymlaqniaeaasgidklvsrvlvlaeeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhqB (B:)
    mkkigvilsgcgvydgseiheavltllaisrsgaqavcfapdkqqvdvinhltgeamtet
    rnvlieaaritrgeirplaqadaaeldalivpggfgaaknlsnfaslgsectvdrelkal
    aqamhqagkplgfmciapamlpkifdfplrltigtdidtaevleemgaehvpcpvddivv
    dednkivttpaymlaqniaeaasgidklvsrvlvla