PDB entry 1vhp

View 1vhp on RCSB PDB site
Description: vh-p8, nmr
Class: immunoglobulin
Keywords: nmr, vh domain, antibody, human, immunoglobulin
Deposited on 1996-04-16, released 1996-11-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vh-p8
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMELISED HUMAN VH
    Database cross-references and differences (RAF-indexed):
    • GB AAF75628 (0-116)
      • conflict (4)
      • conflict (43-44)
      • conflict (46)
      • conflict (50)
      • conflict (97-99)
      • conflict (101-102)
    Domains in SCOPe 2.05: d1vhpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vhpA (A:)
    evqlvesggglvqpggslrlscaasgftfssyamswvrqapgkereivsavsgsggstyy
    adsvkgrftisrdnskntlylqmnslraedtavyycarlkkyafdywgqgtlvtvss