PDB entry 1vhp

View 1vhp on RCSB PDB site
Description:
Deposited on 1996-04-16, released 1996-11-08
The last revision prior to the SCOP 1.71 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1vhp__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vhp_ (-)
    evqlvesggglvqpggslrlscaasgftfssyamswvrqapgkereivsavsgsggstyy
    adsvkgrftisrdnskntlylqmnslraedtavyycarlkkyafdywgqgtlvtvss