PDB entry 1vho

View 1vho on RCSB PDB site
Description: Crystal structure of a putative peptidase/endoglucanase
Class: Structural genomics, unknown function
Keywords: structural genomics
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-30, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.212
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: Thermotoga maritima
    Gene: frvX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0D8
      • modified residue (4)
      • modified residue (11)
      • modified residue (115)
      • variant (130)
      • variant (145)
      • modified residue (225)
      • modified residue (307)
      • modified residue (313)
    Domains in SCOP 1.73: d1vhoa1, d1vhoa2
  • Heterogens: CAC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhoA (A:)
    mslkmetgkllmelsnldgpsgyetnvvsyiksviepfvdeakttrhgsligykkgkgig
    klaffahvdeigfvvskvegqfarlepvggvdpkvvyaskvriytkngiergvigmlaph
    lqdsesrkkvptydeifvdlslcergvrvgdiavidqtafetngkvvgkaldnrascgvl
    vkvleflkrydhpwdvyvvfsvqeetgclgaltgayeinpdaaivmdvtfaseppfsdhi
    elgkgpviglgpvvdrnlvqkiieiakkhnvslqeeavggrsgtetdfvqlvrngvrtsl
    isiplkymhtpvemvdprdveelarllslvaveleveggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhoA (A:)
    metgkllmelsnldgpsgyetnvvsyiksviepfvdeakttrhgsligykkgkgigklaf
    fahvdeigfvvskvegqfarlepvyaskvriytkngiergvigmlaphlqdsesrkkvpt
    ydeifvdlslcergvrvgdiavidqtafetngkvvgkaldnrascgvlvkvleflkrydh
    pwdvyvvfsvqeetgclgaltgayeinpdaaivmdvtfaseppfsdhielgkgpviglgp
    vvdrnlvqkiieiakkhnvslqeeavggrtdfvqlvrngvrtslisiplkymhtpvemvd
    prdveelarllslvavele