PDB entry 1vhn

View 1vhn on RCSB PDB site
Description: Crystal structure of a putative flavin oxidoreductase with flavin
Class: Structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.189
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative flavin oxidoreducatase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: yacF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXV1 (Start-307)
      • modified residue (11)
      • modified residue (35)
      • modified residue (43)
      • variant (100)
      • modified residue (266)
      • modified residue (288)
      • modified residue (299)
      • cloning artifact (308)
    Domains in SCOPe 2.06: d1vhna1, d1vhna2
  • Heterogens: SO4, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhnA (A:)
    mslevkvglapmagytdsafrtlafewgadfafsemvsakgflmnsqkteellpqphern
    vavqifgsepnelseaarilsekykwidlnagcpvrkvvkegaggallkdlrhfryivre
    lrksvsgkfsvktrlgwekneveeiyrilveegvdevfihtrtvvqsftgraewkalsvl
    ekriptfvsgdiftpedakraleesgcdgllvargaigrpwifkqikdflrsgkysepsr
    eeilrtferhlelliktkgerkavvemrkflagytkdlkgarrfrekvmkieevqilkem
    fynfikeveggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhnA (A:)
    vkvglapmagytdsafrtlafewgadfafsemvsakgflmnsqkteellpqphernvavq
    ifgsepnelseaarilsekykwidlnagcpvrkvvkegaggallkdlrhfryivrelrks
    vsgkfsvktrlgwekneveeiyrilveegvdevfihtrtvvqsftgraewkalsvlekri
    ptfvsgdiftpedakraleesgcdgllvargaigrpwifkqikdflrsgkysepsreeil
    rtferhlelliktkgerkavvemrkflagytkdlkgarrfrekvmkieevqilkemfynf
    ikeve