PDB entry 1vhm

View 1vhm on RCSB PDB site
Description: Crystal structure of an hypothetical protein
Class: Structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein yebR
    Species: Escherichia coli [TaxId:562]
    Gene: YEBR, B1832
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vhma_
  • Chain 'B':
    Compound: Protein yebR
    Species: Escherichia coli [TaxId:562]
    Gene: YEBR, B1832
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vhmb_
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhmA (A:)
    mslliligwqiqvrqpsdyimnktefyadlnrdfnalmagetsflatlantsallyerlt
    dinwagfylleddtlvlgpfqgkiacvripvgrgvcgtavarnqvqriedvhvfdghiac
    daasnseivlplvvknqiigvldidstvfgrftdedeqglrqlvaqlekvlattdykkff
    asvageggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhmA (A:)
    nktefyadlnrdfnalmagetsflatlantsallyerltdinwagfylleddtlvlgpfq
    gkiacvripvgrgvcgtavarnqvqriedvhvfdghiacdaasnseivlplvvknqiigv
    ldidstvfgrftdedeqglrqlvaqlekvlattdykkff
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vhmB (B:)
    mslliligwqiqvrqpsdyimnktefyadlnrdfnalmagetsflatlantsallyerlt
    dinwagfylleddtlvlgpfqgkiacvripvgrgvcgtavarnqvqriedvhvfdghiac
    daasnseivlplvvknqiigvldidstvfgrftdedeqglrqlvaqlekvlattdykkff
    asvageggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhmB (B:)
    mnktefyadlnrdfnalmagetsflatlantsallyerltdinwagfylleddtlvlgpf
    qgkiacvripvgrgvcgtavarnqvqriedvhvfdghiacdaasnseivlplvvknqiig
    vldidstvfgrftdedeqglrqlvaqlekvlattdykkff