PDB entry 1vhk

View 1vhk on RCSB PDB site
Description: crystal structure of an hypothetical protein
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.27
AEROSPACI score: -1.77 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhkA (A:)
    mslqryfieltkqqieeaptfsitgeevhhivnvmrmnegdqiiccsqdgfeakcelqsv
    skdkvsclviewtnenrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvv
    klddkkakkkrerwtkiakeaaeqsyrnevprvmdvhsfqqllqrmqdfdkcvvayeess
    kqgeisafsaivsslpkgssllivfgpegglteaeverlteqdgvtcglgprilrtetap
    lyalsaisyqtellrgdqeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhkA (A:)
    qryfieltkqqieeaptfsitgeevhhivnvmrmnegdqiiccsqdgfeakcelqsvskd
    kvsclviewtnenrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvvkre
    rwtkiakeaaeqsyrnevprvmdvhsfqqllqrmqdfdkcvvayesafsaivsslpkgss
    llivfgpegglteaeverlteqdgvtcglgprilrtetaplyalsaisyqtellr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vhkB (B:)
    mslqryfieltkqqieeaptfsitgeevhhivnvmrmnegdqiiccsqdgfeakcelqsv
    skdkvsclviewtnenrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvv
    klddkkakkkrerwtkiakeaaeqsyrnevprvmdvhsfqqllqrmqdfdkcvvayeess
    kqgeisafsaivsslpkgssllivfgpegglteaeverlteqdgvtcglgprilrtetap
    lyalsaisyqtellrgdqeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhkB (B:)
    qryfieltkqiiccsqdgfeakcclviewtnenrelpikvyiasglpkgdklewiiqkgt
    elgahafipfqaarsvvrerwtkiakeaaeqsyrnevprvmdvhsfqqllqrmqdfdkcv
    vayeessafsaivsslpkgssllivfgpegglteaeverlteqdgvtcglgprilrteta
    plyalsaisyqtellr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vhkC (C:)
    mslqryfieltkqqieeaptfsitgeevhhivnvmrmnegdqiiccsqdgfeakcelqsv
    skdkvsclviewtnenrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvv
    klddkkakkkrerwtkiakeaaeqsyrnevprvmdvhsfqqllqrmqdfdkcvvayeess
    kqgeisafsaivsslpkgssllivfgpegglteaeverlteqdgvtcglgprilrtetap
    lyalsaisyqtellrgdqeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhkC (C:)
    qryfieltkqqieeaptfsitgeevhhivnvmrmnegdqiiccsqdgfeakcelqsvskd
    kvsclviewtnenrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvvkld
    dkkakkkrerwtkiakeaaeqsyrnevprvmdvhsfqqllqrmqdfdkcvvayesafsai
    vsslpkgssllivfgpegglteaeverlteqdgvtcglgprilrtetaplyalsaisyqt
    ellr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vhkD (D:)
    mslqryfieltkqqieeaptfsitgeevhhivnvmrmnegdqiiccsqdgfeakcelqsv
    skdkvsclviewtnenrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvv
    klddkkakkkrerwtkiakeaaeqsyrnevprvmdvhsfqqllqrmqdfdkcvvayeess
    kqgeisafsaivsslpkgssllivfgpegglteaeverlteqdgvtcglgprilrtetap
    lyalsaisyqtellrgdqeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhkD (D:)
    qryficcsqdgfeaenrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvk
    rerwtkiakeaaeqsyrnevprvmdvhsfqqllqrmqdfdkcvvayeesafsaivsslpk
    gssllivfgpegglteaeverlteqdgvtcglgprilrtetaplyalsaisyqtellr