PDB entry 1vhk

View 1vhk on RCSB PDB site
Description: Crystal structure of an hypothetical protein
Class: Structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: -1.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yqeU
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YQEU, BSU25440
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54461 (3-End)
      • modified residue (34)
      • modified residue (36)
      • modified residue (153)
      • modified residue (165)
    Domains in SCOPe 2.07: d1vhka1, d1vhka2
  • Chain 'B':
    Compound: Hypothetical protein yqeU
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YQEU, BSU25440
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54461 (3-End)
      • modified residue (153)
      • modified residue (165)
    Domains in SCOPe 2.07: d1vhkb1, d1vhkb2
  • Chain 'C':
    Compound: Hypothetical protein yqeU
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YQEU, BSU25440
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54461 (3-End)
      • modified residue (34)
      • modified residue (36)
      • modified residue (153)
      • modified residue (165)
    Domains in SCOPe 2.07: d1vhkc1, d1vhkc2
  • Chain 'D':
    Compound: Hypothetical protein yqeU
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YQEU, BSU25440
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54461 (3-End)
      • modified residue (153)
      • modified residue (165)
    Domains in SCOPe 2.07: d1vhkd1, d1vhkd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhkA (A:)
    mslqryfieltkqqieeaptfsitgeevhhivnvmrmnegdqiiccsqdgfeakcelqsv
    skdkvsclviewtnenrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvv
    klddkkakkkrerwtkiakeaaeqsyrnevprvmdvhsfqqllqrmqdfdkcvvayeess
    kqgeisafsaivsslpkgssllivfgpegglteaeverlteqdgvtcglgprilrtetap
    lyalsaisyqtellrgdqeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhkA (A:)
    qryfieltkqqieeaptfsitgeevhhivnvmrmnegdqiiccsqdgfeakcelqsvskd
    kvsclviewtnenrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvvkre
    rwtkiakeaaeqsyrnevprvmdvhsfqqllqrmqdfdkcvvayesafsaivsslpkgss
    llivfgpegglteaeverlteqdgvtcglgprilrtetaplyalsaisyqtellr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vhkB (B:)
    mslqryfieltkqqieeaptfsitgeevhhivnvmrmnegdqiiccsqdgfeakcelqsv
    skdkvsclviewtnenrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvv
    klddkkakkkrerwtkiakeaaeqsyrnevprvmdvhsfqqllqrmqdfdkcvvayeess
    kqgeisafsaivsslpkgssllivfgpegglteaeverlteqdgvtcglgprilrtetap
    lyalsaisyqtellrgdqeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhkB (B:)
    qryfieltkqiiccsqdgfeakcclviewtnenrelpikvyiasglpkgdklewiiqkgt
    elgahafipfqaarsvvrerwtkiakeaaeqsyrnevprvmdvhsfqqllqrmqdfdkcv
    vayeessafsaivsslpkgssllivfgpegglteaeverlteqdgvtcglgprilrteta
    plyalsaisyqtellr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vhkC (C:)
    mslqryfieltkqqieeaptfsitgeevhhivnvmrmnegdqiiccsqdgfeakcelqsv
    skdkvsclviewtnenrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvv
    klddkkakkkrerwtkiakeaaeqsyrnevprvmdvhsfqqllqrmqdfdkcvvayeess
    kqgeisafsaivsslpkgssllivfgpegglteaeverlteqdgvtcglgprilrtetap
    lyalsaisyqtellrgdqeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhkC (C:)
    qryfieltkqqieeaptfsitgeevhhivnvmrmnegdqiiccsqdgfeakcelqsvskd
    kvsclviewtnenrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvvkld
    dkkakkkrerwtkiakeaaeqsyrnevprvmdvhsfqqllqrmqdfdkcvvayesafsai
    vsslpkgssllivfgpegglteaeverlteqdgvtcglgprilrtetaplyalsaisyqt
    ellr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vhkD (D:)
    mslqryfieltkqqieeaptfsitgeevhhivnvmrmnegdqiiccsqdgfeakcelqsv
    skdkvsclviewtnenrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvv
    klddkkakkkrerwtkiakeaaeqsyrnevprvmdvhsfqqllqrmqdfdkcvvayeess
    kqgeisafsaivsslpkgssllivfgpegglteaeverlteqdgvtcglgprilrtetap
    lyalsaisyqtellrgdqeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhkD (D:)
    qryficcsqdgfeaenrelpikvyiasglpkgdklewiiqkgtelgahafipfqaarsvk
    rerwtkiakeaaeqsyrnevprvmdvhsfqqllqrmqdfdkcvvayeesafsaivsslpk
    gssllivfgpegglteaeverlteqdgvtcglgprilrtetaplyalsaisyqtellr