PDB entry 1vhj

View 1vhj on RCSB PDB site
Description: Crystal structure of purine nucleoside phosphorylase
Class: transferase
Keywords: structural genomics, Transferase
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KPM0 (3-End)
      • variant (58)
    Domains in SCOPe 2.07: d1vhja_
  • Chain 'B':
    Compound: purine nucleoside phosphorylase
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KPM0 (3-End)
      • variant (58)
    Domains in SCOPe 2.07: d1vhjb_
  • Chain 'C':
    Compound: purine nucleoside phosphorylase
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KPM0 (3-End)
      • variant (58)
    Domains in SCOPe 2.07: d1vhjc_
  • Chain 'D':
    Compound: purine nucleoside phosphorylase
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KPM0 (3-End)
      • variant (58)
    Domains in SCOPe 2.07: d1vhjd_
  • Chain 'E':
    Compound: purine nucleoside phosphorylase
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KPM0 (3-End)
      • variant (58)
    Domains in SCOPe 2.07: d1vhje_
  • Chain 'F':
    Compound: purine nucleoside phosphorylase
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KPM0 (3-End)
      • variant (58)
    Domains in SCOPe 2.07: d1vhjf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhjA (A:)
    mslatphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrri
    svmghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnr
    irfkdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivg
    vemeaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq
    agyeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhjA (A:)
    atphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrrisvm
    ghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirf
    kdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgvem
    eaagiygvaaeygakalaictvsdhiktgeseerqntfnemieialdsvligdq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vhjB (B:)
    mslatphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrri
    svmghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnr
    irfkdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivg
    vemeaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq
    agyeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhjB (B:)
    atphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrrisvm
    ghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirf
    kdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgvem
    eaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vhjC (C:)
    mslatphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrri
    svmghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnr
    irfkdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivg
    vemeaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq
    agyeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhjC (C:)
    atphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrrisvm
    ghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirf
    kdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgvem
    eaagiygvaaeygakalaictvsdhiktgeerqntfnemieialdsvligdq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vhjD (D:)
    mslatphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrri
    svmghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnr
    irfkdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivg
    vemeaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq
    agyeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhjD (D:)
    atphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrrisvm
    ghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirf
    kdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgvem
    eaagiygvaaeygakalaictvsdhiktgeerqntfnemieialdsvligdq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vhjE (E:)
    mslatphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrri
    svmghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnr
    irfkdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivg
    vemeaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq
    agyeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhjE (E:)
    atphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrrisvm
    ghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirf
    kdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgvem
    eaagiygvaaeygakalaictvsdhiktgeerqntfnemieialdsvligdq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vhjF (F:)
    mslatphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrri
    svmghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnr
    irfkdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivg
    vemeaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq
    agyeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhjF (F:)
    atphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrrisvm
    ghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirf
    kdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgvem
    eaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdq