PDB entry 1vhi

View 1vhi on RCSB PDB site
Description: epstein barr virus nuclear antigen-1 DNA-binding domain, residues 470-607
Class: nuclear protein
Keywords: nuclear protein, DNA-binding, activator, origin-binding protein
Deposited on 1996-10-05, released 1996-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.179
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epstein barr virus nuclear antigen-1
    Species: Human herpesvirus 4 [TaxId:10376]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03211 (Start-141)
      • conflict (3)
    Domains in SCOPe 2.06: d1vhia_
  • Chain 'B':
    Compound: epstein barr virus nuclear antigen-1
    Species: Human herpesvirus 4 [TaxId:10376]
    Gene: E2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vhib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhiA (A:)
    gshmgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgta
    laipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmt
    kpaptcnirvtvcsfddgvdlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhiA (A:)
    mgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalai
    pqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpa
    ptcnirvtvcsfddgvdlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vhiB (B:)
    gshmgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgta
    laipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmt
    kpaptcnirvtvcsfddgvdlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhiB (B:)
    pkfeniaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrltp
    lsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcnirv
    tvcsfddgvdlp