PDB entry 1vhh

View 1vhh on RCSB PDB site
Description: a potential catalytic site within the amino-terminal signalling domain of sonic hedgehog
Class: signalling protein
Keywords: signalling protein
Deposited on 1995-10-03, released 1996-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sonic hedgehog
    Species: Mus musculus [TaxId:10090]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vhha_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhhA (A:)
    rrhpkkltplaykqfipnvaektlgasgryegkitrnserfkeltpnynpdiifkdeent
    gadrlmtqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsd
    rdrskygmlarlaveagfdwvyyeskahihcsvkaensvaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhhA (A:)
    kltplaykqfipnvaektlgasgryegkitrnserfkeltpnynpdiifkdeentgadrl
    mtqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrsk
    ygmlarlaveagfdwvyyeskahihcsvkaensvaak