PDB entry 1vhg

View 1vhg on RCSB PDB site
Description: Crystal structure of ADP compounds hydrolase
Class: hydrolase
Keywords: structural genomics, HYDROLASE
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP compounds hydrolase nudE
    Species: Escherichia coli [TaxId:562]
    Gene: NUDE, B3397
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45799 (3-187)
      • modified residue (43)
      • modified residue (52)
      • modified residue (116)
      • modified residue (125)
      • modified residue (156-157)
    Domains in SCOPe 2.07: d1vhga_
  • Chain 'B':
    Compound: ADP compounds hydrolase nudE
    Species: Escherichia coli [TaxId:562]
    Gene: NUDE, B3397
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45799 (3-187)
      • modified residue (43)
      • modified residue (52)
      • modified residue (116)
      • modified residue (125)
      • modified residue (156-157)
    Domains in SCOPe 2.07: d1vhgb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhgA (A:)
    mslskslqkptilnvetvarsrlftvesvdlefsngvrrvyermrptnreavmivpivdd
    hlilireyavgtesyelgfskglidpgesvyeaanrelkeevgfgandltflkklsmaps
    yfsskmnivvaqdlypeslegdepeplpqvrwplahmmdlledpdfnearnvsalflvre
    wlkgqgrveggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhgA (A:)
    skslqkptilnvetvarsrlftvesvdlefsngvrrvyermrptnreavmivpivddhli
    lireyavgtesyelgfskglidpgesvyeaanrelkeevgfgandltflkklsmapsyfs
    skmnivvaqdlypeslegdepeplpqvrwplahmmdlledpdfnearnvsalflvrewlk
    gqgrv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vhgB (B:)
    mslskslqkptilnvetvarsrlftvesvdlefsngvrrvyermrptnreavmivpivdd
    hlilireyavgtesyelgfskglidpgesvyeaanrelkeevgfgandltflkklsmaps
    yfsskmnivvaqdlypeslegdepeplpqvrwplahmmdlledpdfnearnvsalflvre
    wlkgqgrveggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhgB (B:)
    skslqkptilnvetvarsrlftvesvdlefsngvrrvyermrptnreavmivpivddhli
    lireyavgtesyelgfskglidpgesvyeaanrelkeevgfgandltflkklsmapsyfs
    skmnivvaqdlypeslegdepeplpqvrwplahmmdlledpdfnearnvsalflvrewlk
    gqgrv