PDB entry 1vhf

View 1vhf on RCSB PDB site
Description: Crystal structure of periplasmic divalent cation tolerance protein
Class: Structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.185
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Periplasmic divalent cation tolerance protein
    Species: Thermotoga maritima [TaxId:2336]
    Gene: CUTA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0E6 (3-End)
      • cloning artifact (1-2)
      • modified residue (94)
    Domains in SCOPe 2.04: d1vhfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1vhfA (A:)
mslilvystfpneekaleigrkllekrliacfnafeirsgywwkgeivqdkewaaifktt
eekekelyeelrklhpyetpaiftlkvenvlteymnwlresvleggshhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1vhfA (A:)
slilvystfpneekaleigrkllekrliacfnafeirsgywwkgeivqdkewaaifktte
ekekelyeelrklhpyetpaiftlkvenvlteymnwlresv