PDB entry 1vhf

View 1vhf on RCSB PDB site
Description: crystal structure of periplasmic divalent cation tolerance protein
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOP 1.69 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.185
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1vhfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhfA (A:)
    mslilvystfpneekaleigrkllekrliacfnafeirsgywwkgeivqdkewaaifktt
    eekekelyeelrklhpyetpaiftlkvenvlteymnwlresvleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhfA (A:)
    slilvystfpneekaleigrkllekrliacfnafeirsgywwkgeivqdkewaaifktte
    ekekelyeelrklhpyetpaiftlkvenvlteymnwlresv