PDB entry 1vhe

View 1vhe on RCSB PDB site
Description: Crystal structure of a aminopeptidase/glucanase homolog
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOP 1.69 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.176
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vheA (A:)
    mslakldetltmlkdltdakgipgnerevrqvmksyiepfadevttdrlgsliakktgae
    ngpkimiaghldevgfmvtqitdkgfirfqtvggwwaqvmlaqrvtivtkkgeitgvigs
    kpphilspearkksveikdmfidigassreealewgvlpgdmivphfeftvmnnekflla
    kawdnrigcaiaidvlrnlqntdhpnivygvgtvqeevglrgaktaahtiqpdiafgvdv
    giagdtpgisekeaqskmgkgpqiivydasmvshkglrdavvataeeagipyqfdaiagg
    gtdsgaihltangvpalsitiatryihthaamlhrddyenavklitevikkldrktvdei
    tyqeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vheA (A:)
    kldetltmlkdltdakgipgnerevrqvmksyiepfadevttdrlgsliakktgaengpk
    imiaghldevgfmvtqitdkgfirfqtvggwwaqvmlaqrvtivtkkgeitgvigskpph
    ilspearkksveikdmfidigassreealewgvlpgdmivphfeftvmnnekfllakawd
    nrigcaiaidvlrnlqntdhpnivygvgtvqeevglrgaktaahtiqpdiafgvdvgiag
    dtpgisekeaqskmgkgpqiivydasmvshkglrdavvataeeagipyqfdaiagggtds
    gaihltangvpalsitiatryihthaamlhrddyenavklitevikkldrktvdeityqe
    ggshh