PDB entry 1vhe

View 1vhe on RCSB PDB site
Description: Crystal structure of a aminopeptidase/glucanase homolog
Class: Structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.176
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminopeptidase/glucanase homolog
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ysdC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P94521 (Start-362)
      • modified residue (11)
      • modified residue (32)
      • modified residue (65)
      • modified residue (76)
      • modified residue (99)
      • modified residue (139)
      • modified residue (161)
      • modified residue (171)
      • modified residue (257)
      • modified residue (270)
      • modified residue (331)
      • cloning artifact (363-368)
    Domains in SCOPe 2.07: d1vhea1, d1vhea2, d1vhea3
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vheA (A:)
    mslakldetltmlkdltdakgipgnerevrqvmksyiepfadevttdrlgsliakktgae
    ngpkimiaghldevgfmvtqitdkgfirfqtvggwwaqvmlaqrvtivtkkgeitgvigs
    kpphilspearkksveikdmfidigassreealewgvlpgdmivphfeftvmnnekflla
    kawdnrigcaiaidvlrnlqntdhpnivygvgtvqeevglrgaktaahtiqpdiafgvdv
    giagdtpgisekeaqskmgkgpqiivydasmvshkglrdavvataeeagipyqfdaiagg
    gtdsgaihltangvpalsitiatryihthaamlhrddyenavklitevikkldrktvdei
    tyqeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vheA (A:)
    kldetltmlkdltdakgipgnerevrqvmksyiepfadevttdrlgsliakktgaengpk
    imiaghldevgfmvtqitdkgfirfqtvggwwaqvmlaqrvtivtkkgeitgvigskpph
    ilspearkksveikdmfidigassreealewgvlpgdmivphfeftvmnnekfllakawd
    nrigcaiaidvlrnlqntdhpnivygvgtvqeevglrgaktaahtiqpdiafgvdvgiag
    dtpgisekeaqskmgkgpqiivydasmvshkglrdavvataeeagipyqfdaiagggtds
    gaihltangvpalsitiatryihthaamlhrddyenavklitevikkldrktvdeityqe
    ggshh