PDB entry 1vhd

View 1vhd on RCSB PDB site
Description: Crystal structure of an iron containing alcohol dehydrogenase
Class: oxidoreductase
Keywords: structural genomics, OXIDOREDUCTASE
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.19
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alcohol dehydrogenase, iron-containing
    Species: Thermotoga maritima [TaxId:2336]
    Gene: gbsB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X022 (3-360)
      • cloning artifact (1-2)
      • modified residue (7)
      • modified residue (77)
      • modified residue (100)
      • modified residue (164)
      • modified residue (179)
      • modified residue (216)
      • modified residue (237)
      • modified residue (246)
      • modified residue (277)
      • modified residue (283)
      • modified residue (286)
      • cloning artifact (361)
    Domains in SCOPe 2.07: d1vhda1, d1vhda2, d1vhda3
  • Chain 'B':
    Compound: Alcohol dehydrogenase, iron-containing
    Species: Thermotoga maritima [TaxId:2336]
    Gene: gbsB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X022 (3-360)
      • cloning artifact (1-2)
      • modified residue (7)
      • modified residue (77)
      • modified residue (100)
      • modified residue (164)
      • modified residue (179)
      • modified residue (216)
      • modified residue (237)
      • modified residue (246)
      • modified residue (277)
      • modified residue (283)
      • modified residue (286)
      • cloning artifact (361)
    Domains in SCOPe 2.07: d1vhdb1, d1vhdb2, d1vhdb3
  • Heterogens: CAC, ZN, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhdA (A:)
    mslwefymptdvffgekilekrgniidllgkralvvtgkssskkngslddlkklldetei
    syeifdeveenpsfdnvmkaveryrndsfdfvvglgggspmdfakavavllkekdlsved
    lydrekvkhwlpvveipttagtgsevtpysiltdpegnkrgctlmfpvyafldprytysm
    sdeltlstgvdalshavegylsrkstppsdalaieamkiihrnlpkaiegnrearkkmfv
    asclagmviaqtgttlahalgyplttekgikhgkatgmvlpfvmevmkeeipekvdtvnh
    ifggsllkflkelglyekvavsseelekwvekgsrakhlkntpgtftpekirniyrealg
    veggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhdA (A:)
    slwefymptdvffgekilekrgniidllgkralvvtgkssskkngslddlkklldeteis
    yeifdeveenpsfdnvmkaveryrndsfdfvvglgggspmdfakavavllkekdlsvedl
    ydrekvkhwlpvveipttagtgsevtpysiltdpegnkrgctlmfpvyafldprytysms
    deltlstgvdalshavegylsrkstppsdalaieamkiihrnlpkaiegnrearkkmfva
    sclagmviaqtgttlahalgyplttekgikhgkatgmvlpfvmevmkeeipekvdtvnhi
    fggsllkflkelglyekvavsseelekwvekgsrakhlkntpgtftpekirniyrealgv
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vhdB (B:)
    mslwefymptdvffgekilekrgniidllgkralvvtgkssskkngslddlkklldetei
    syeifdeveenpsfdnvmkaveryrndsfdfvvglgggspmdfakavavllkekdlsved
    lydrekvkhwlpvveipttagtgsevtpysiltdpegnkrgctlmfpvyafldprytysm
    sdeltlstgvdalshavegylsrkstppsdalaieamkiihrnlpkaiegnrearkkmfv
    asclagmviaqtgttlahalgyplttekgikhgkatgmvlpfvmevmkeeipekvdtvnh
    ifggsllkflkelglyekvavsseelekwvekgsrakhlkntpgtftpekirniyrealg
    veggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhdB (B:)
    slwefymptdvffgekilekrgniidllgkralvvtgkssskkngslddlkklldeteis
    yeifdeveenpsfdnvmkaveryrndsfdfvvglgggspmdfakavavllkekdlsvedl
    ydrekvkhwlpvveipttagtgsevtpysiltdpegnkrgctlmfpvyafldprytysms
    deltlstgvdalshavegylsrkstppsdalaieamkiihrnlpkaiegnrearkkmfva
    sclagmviaqtgttlahalgyplttekgikhgkatgmvlpfvmevmkeeipekvdtvnhi
    fggsllkflkelglyekvavsseelekwvekgsrakhlkntpgtftpekirniyrealgv
    e