PDB entry 1vhc

View 1vhc on RCSB PDB site
Description: Crystal structure of a putative KHG/KDPG aldolase
Class: Structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative KHG/KDPG aldolase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: EDA, HI0047
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44480 (3-213)
      • modified residue (120)
      • modified residue (128)
      • modified residue (146)
      • modified residue (160)
      • cloning artifact (214)
    Domains in SCOPe 2.07: d1vhca1, d1vhca2
  • Chain 'B':
    Compound: Putative KHG/KDPG aldolase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: EDA, HI0047
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44480 (3-213)
      • modified residue (120)
      • modified residue (128)
      • modified residue (146)
      • modified residue (160)
      • cloning artifact (214)
    Domains in SCOPe 2.07: d1vhcb1, d1vhcb2
  • Chain 'C':
    Compound: Putative KHG/KDPG aldolase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: EDA, HI0047
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44480 (3-213)
      • modified residue (120)
      • modified residue (128)
      • modified residue (146)
      • modified residue (160)
      • cloning artifact (214)
    Domains in SCOPe 2.07: d1vhcc1, d1vhcc2
  • Chain 'D':
    Compound: Putative KHG/KDPG aldolase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: EDA, HI0047
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44480 (3-213)
      • modified residue (120)
      • modified residue (128)
      • modified residue (146)
      • modified residue (160)
      • cloning artifact (214)
    Domains in SCOPe 2.07: d1vhcd1, d1vhcd2
  • Chain 'E':
    Compound: Putative KHG/KDPG aldolase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: EDA, HI0047
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44480 (3-213)
      • modified residue (120)
      • modified residue (128)
      • modified residue (146)
      • modified residue (160)
      • cloning artifact (214)
    Domains in SCOPe 2.07: d1vhce1, d1vhce2
  • Chain 'F':
    Compound: Putative KHG/KDPG aldolase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: EDA, HI0047
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44480 (3-213)
      • cloning artifact (2)
      • modified residue (120)
      • modified residue (128)
      • modified residue (146)
      • modified residue (160)
      • cloning artifact (214)
    Domains in SCOPe 2.07: d1vhcf1, d1vhcf2, d1vhcf3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhcA (A:)
    mslsyttqqiieklrelkivpvialdnaddilpladtlaknglsvaeitfrseaaadair
    llranrpdfliaagtvltaeqvvlakssgadfvvtpglnpkivklcqdlnfpitpgvnnp
    maieialemgisavkffpaeasggvkmikallgpyaqlqimptggiglhnirdylaipni
    vacggswfvekkliqsnnwdeigrlvrevidiikeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhcA (A:)
    syttqqiieklrelkivpvialdnaddilpladtlaknglsvaeitfrseaaadairllr
    anrpdfliaagtvltaeqvvlakssgadfvvtpglnpkivklcqdlnfpitpgvnnpmai
    eialemgisavkffpaeasggvkmikallgpyaqlqimptggiglhnirdylaipnivac
    ggswfvekkliqsnnwdeigrlvrevidiike
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vhcB (B:)
    mslsyttqqiieklrelkivpvialdnaddilpladtlaknglsvaeitfrseaaadair
    llranrpdfliaagtvltaeqvvlakssgadfvvtpglnpkivklcqdlnfpitpgvnnp
    maieialemgisavkffpaeasggvkmikallgpyaqlqimptggiglhnirdylaipni
    vacggswfvekkliqsnnwdeigrlvrevidiikeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhcB (B:)
    syttqqiieklrelkivpvialdnaddilpladtlaknglsvaeitfrseaaadairllr
    anrpdfliaagtvltaeqvvlakssgadfvvtpglnpkivklcqdlnfpitpgvnnpmai
    eialemgisavkffpaeasggvkmikallgpyaqlqimptggiglhnirdylaipnivac
    ggswfvekkliqsnnwdeigrlvrevidiike
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vhcC (C:)
    mslsyttqqiieklrelkivpvialdnaddilpladtlaknglsvaeitfrseaaadair
    llranrpdfliaagtvltaeqvvlakssgadfvvtpglnpkivklcqdlnfpitpgvnnp
    maieialemgisavkffpaeasggvkmikallgpyaqlqimptggiglhnirdylaipni
    vacggswfvekkliqsnnwdeigrlvrevidiikeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhcC (C:)
    syttqqiieklrelkivpvialdnaddilpladtlaknglsvaeitfrseaaadairllr
    anrpdfliaagtvltaeqvvlakssgadfvvtpglnpkivklcqdlnfpitpgvnnpmai
    eialemgisavkffpaeasggvkmikallgpyaqlqimptggiglhnirdylaipnivac
    ggswfvekkliqsnnwdeigrlvrevidiike
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vhcD (D:)
    mslsyttqqiieklrelkivpvialdnaddilpladtlaknglsvaeitfrseaaadair
    llranrpdfliaagtvltaeqvvlakssgadfvvtpglnpkivklcqdlnfpitpgvnnp
    maieialemgisavkffpaeasggvkmikallgpyaqlqimptggiglhnirdylaipni
    vacggswfvekkliqsnnwdeigrlvrevidiikeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhcD (D:)
    syttqqiieklrelkivpvialdnaddilpladtlaknglsvaeitfrseaaadairllr
    anrpdfliaagtvltaeqvvlakssgadfvvtpglnpkivklcqdlnfpitpgvnnpmai
    eialemgisavkffpaeasggvkmikallgpyaqlqimptggiglhnirdylaipnivac
    ggswfvekkliqsnnwdeigrlvrevidiike
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vhcE (E:)
    mslsyttqqiieklrelkivpvialdnaddilpladtlaknglsvaeitfrseaaadair
    llranrpdfliaagtvltaeqvvlakssgadfvvtpglnpkivklcqdlnfpitpgvnnp
    maieialemgisavkffpaeasggvkmikallgpyaqlqimptggiglhnirdylaipni
    vacggswfvekkliqsnnwdeigrlvrevidiikeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhcE (E:)
    syttqqiieklrelkivpvialdnaddilpladtlaknglsvaeitfrseaaadairllr
    anrpdfliaagtvltaeqvvlakssgadfvvtpglnpkivklcqdlnfpitpgvnnpmai
    eialemgisavkffpaeasggvkmikallgpyaqlqimptggiglhnirdylaipnivac
    ggswfvekkliqsnnwdeigrlvrevidiike
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vhcF (F:)
    mslsyttqqiieklrelkivpvialdnaddilpladtlaknglsvaeitfrseaaadair
    llranrpdfliaagtvltaeqvvlakssgadfvvtpglnpkivklcqdlnfpitpgvnnp
    maieialemgisavkffpaeasggvkmikallgpyaqlqimptggiglhnirdylaipni
    vacggswfvekkliqsnnwdeigrlvrevidiikeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhcF (F:)
    lsyttqqiieklrelkivpvialdnaddilpladtlaknglsvaeitfrseaaadairll
    ranrpdfliaagtvltaeqvvlakssgadfvvtpglnpkivklcqdlnfpitpgvnnpma
    ieialemgisavkffpaeasggvkmikallgpyaqlqimptggiglhnirdylaipniva
    cggswfvekkliqsnnwdeigrlvrevidiike