PDB entry 1vhb

View 1vhb on RCSB PDB site
Description: bacterial dimeric hemoglobin from vitreoscilla stercoraria
Class: oxygen transport
Keywords: heme, respiratory protein, oxygen transport
Deposited on 1997-02-19, released 1998-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.184
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin
    Species: Vitreoscilla stercoraria [TaxId:61]
    Gene: VGB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vhba_
  • Chain 'B':
    Compound: hemoglobin
    Species: Vitreoscilla stercoraria [TaxId:61]
    Gene: VGB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vhbb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhbA (A:)
    mldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamt
    vlaaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddild
    awgkaygviadvfiqveadlyaqave
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhbA (A:)
    ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfqpkalamtvlaaaqnien
    lpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygvia
    dvfiqveadlyaqav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vhbB (B:)
    mldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamt
    vlaaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddild
    awgkaygviadvfiqveadlyaqave
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhbB (B:)
    ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfqpkalamtvlaaaqnien
    lpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygvia
    dvfiqveadlyaqav