PDB entry 1vh9

View 1vh9 on RCSB PDB site
Description: Crystal structure of a putative thioesterase
Class: Structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.23
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ybdB
    Species: Escherichia coli [TaxId:562]
    Gene: YBDB, B0597, C0684
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8Y8 (3-138)
      • cloning artifact (1-2)
    Domains in SCOPe 2.02: d1vh9a_
  • Chain 'B':
    Compound: Hypothetical protein ybdB
    Species: Escherichia coli [TaxId:562]
    Gene: YBDB, B0597, C0684
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8Y8 (3-138)
      • cloning artifact (1-2)
    Domains in SCOPe 2.02: d1vh9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vh9A (A:)
    msliwkrhltldelnatsdntmvahlgivytrlgddvleaempvdtrthqpfgllhggas
    aalaetlgsmagfmmtrdgqcvvgtelnathhrpvsegkvrgvcqplhlgrqnqsweivv
    fdeqgrrcctcrlgtavlgeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh9A (A:)
    sliwkrhltldelnatsdntmvahlgivytrlgddvleaempvdtrthqpfgllhggasa
    alaetlgsmagfmmtrdgqcvvgtelnathhrpvsegkvrgvcqplhlgrqnqsweivvf
    deqgrrcctcrlgtavlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vh9B (B:)
    msliwkrhltldelnatsdntmvahlgivytrlgddvleaempvdtrthqpfgllhggas
    aalaetlgsmagfmmtrdgqcvvgtelnathhrpvsegkvrgvcqplhlgrqnqsweivv
    fdeqgrrcctcrlgtavlgeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh9B (B:)
    sliwkrhltldelnatsdntmvahlgivytrlgddvleaempvdtrthqpfgllhggasa
    alaetlgsmagfmmtrdgqcvvgtelnathhrpvsegkvrgvcqplhlgrqnqsweivvf
    deqgrrcctcrlgtavlg