PDB entry 1vh7

View 1vh7 on RCSB PDB site
Description: Crystal structure of a cyclase subunit of imidazolglycerolphosphate synthase
Class: lyase
Keywords: structural genomics, LYASE
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Imidazole glycerol phosphate synthase subunit hisF
    Species: Thermotoga maritima [TaxId:2336]
    Gene: HISF, TM1036
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vh7a_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vh7A (A:)
    msllakriiacldvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvek
    rktmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaq
    tfgsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgt
    ksgydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelk
    eylkkhgvnvrlegleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh7A (A:)
    lakriiacldvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrkt
    mlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtfg
    sqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtksg
    ydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkeyl
    kkhgvnvrle