PDB entry 1vh6

View 1vh6 on RCSB PDB site
Description: crystal structure of a flagellar protein
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOP 1.71 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.263
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1vh6a_
  • Chain 'B':
    Domains in SCOP 1.71: d1vh6b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vh6A (A:)
    mslaiqnpytayqqnsvntatpgeltlmlyngclkfirlaaqaienddmerknenlikaq
    niiqelnftlnrnielsasmgamydymyrrlvqanikndtgmlaevegyvtdfrdawkqa
    iqserkdrhgsggiaeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh6A (A:)
    atpgeltlmlyngclkfirlaaqaienddmerknenlikaqniiqelnftlnrnielsas
    mgamydymyrrlvqanikndtgmlaevegyvtdfrdawkqai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vh6B (B:)
    mslaiqnpytayqqnsvntatpgeltlmlyngclkfirlaaqaienddmerknenlikaq
    niiqelnftlnrnielsasmgamydymyrrlvqanikndtgmlaevegyvtdfrdawkqa
    iqserkdrhgsggiaeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh6B (B:)
    vntatpgeltlmlyngclkfirlaaqaienddmerknenlikaqniiqelnftlnrniel
    sasmgamydymyrrlvqanikndtgmlaevegyvtdfrdawkqaiqse