PDB entry 1vh5

View 1vh5 on RCSB PDB site
Description: Crystal structure of a putative thioesterase
Class: Structural genomics, unknown function
Keywords: PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, Structural genomics, unknown function
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ydiI
    Species: Escherichia coli [TaxId:562]
    Gene: YDII, B1686
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77781 (3-137)
      • cloning artifact (1-2)
      • cloning artifact (138)
    Domains in SCOPe 2.07: d1vh5a1, d1vh5a2, d1vh5a3
  • Chain 'B':
    Compound: Hypothetical protein ydiI
    Species: Escherichia coli [TaxId:562]
    Gene: YDII, B1686
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77781 (3-137)
      • cloning artifact (1-2)
      • cloning artifact (138)
    Domains in SCOPe 2.07: d1vh5b1, d1vh5b2, d1vh5b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vh5A (A:)
    msliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggas
    vvlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqiei
    fdekgrlccssrlttaileggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh5A (A:)
    sliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasv
    vlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieif
    dekgrlccssrlttaile
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vh5B (B:)
    msliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggas
    vvlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqiei
    fdekgrlccssrlttaileggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh5B (B:)
    sliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasv
    vlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieif
    dekgrlccssrlttaile