PDB entry 1vh4

View 1vh4 on RCSB PDB site
Description: Crystal structure of a stabilizer of iron transporter
Class: protein binding protein
Keywords: structural genomics, PROTEIN BINDING PROTEIN
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.212
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SufD protein
    Species: Escherichia coli [TaxId:562]
    Gene: SUFD, B1681
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vh4a_
  • Chain 'B':
    Compound: SufD protein
    Species: Escherichia coli [TaxId:562]
    Gene: SUFD, B1681
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vh4b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vh4A (A:)
    slmaglpnssnalqqwhhlfeaegtkrspqaqqhlqqllrtglptrkhenwkytplegli
    nsqfvsiageispqqrdalaltldsvrlvfvdgryvpalsdategsgyevsinddrqglp
    daiqaevflhlteslaqsvthiavkrgqrpakplllmhitqgvageevntahyrhhldla
    egaeatviehfvslndarhftgarftinvaanahlqhiklafenplshhfahndlllaed
    atafshsfllggavlrhntstqlngenstlrinslampvknevcdtrtwlehnkgfcnsr
    qlhktivsdkgravfnglinvaqhaiktdgqmtnnnllmgklaevdtkpqleiyaddvkc
    shgatvgriddeqifylrsrginqqdaqqmiiyafaaeltealrdeglkqqvlarigqrl
    pggareggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh4A (A:)
    nalqqwhhlfeakrspqaqqhlqqllrtglptrkhenwkytpleglinsqfvsiageisp
    qqrdalaltldsvrlvfvdgryvpalsdategsgyevsinddrqglpdaiqaevflhlte
    slaqsvthiavkrgqrpakplllmhitqgvageevntahyrhhldlaegaeatviehfvs
    lndarhftgarftinvaanahlqhiklafenplshhfahndlllaedatafshsfllgga
    vlrhntstqlngenstlrinslampvknevcdtrtwlehnkgfcnsrqlhktivsdkgra
    vfnglinvaqhaiktdgqmtnnnllmgklaevdtkpqleiyaddvkcshgatvgriddeq
    ifylrsrginqqdaqqmiiyafaaeltealrdeglkqqvlarigqrlpgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vh4B (B:)
    slmaglpnssnalqqwhhlfeaegtkrspqaqqhlqqllrtglptrkhenwkytplegli
    nsqfvsiageispqqrdalaltldsvrlvfvdgryvpalsdategsgyevsinddrqglp
    daiqaevflhlteslaqsvthiavkrgqrpakplllmhitqgvageevntahyrhhldla
    egaeatviehfvslndarhftgarftinvaanahlqhiklafenplshhfahndlllaed
    atafshsfllggavlrhntstqlngenstlrinslampvknevcdtrtwlehnkgfcnsr
    qlhktivsdkgravfnglinvaqhaiktdgqmtnnnllmgklaevdtkpqleiyaddvkc
    shgatvgriddeqifylrsrginqqdaqqmiiyafaaeltealrdeglkqqvlarigqrl
    pggareggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh4B (B:)
    nssnalqqwhhlfeatkrspqaqqhlqqllrtglptrkhenwkytpleglinsqfvsiag
    eispqqrdalaltldsvrlvfvdgryvpalsdategsgyevsinddrqglpdaiqaevfl
    hlteslaqsvthiavkrgqrpakplllmhitqgvageevntahyrhhldlaegaeatvie
    hfvslndarhftgarftinvaanahlqhiklafenplshhfahndlllaedatafshsfl
    lggavlrhntstqlngenstlrinslampvknevcdtrtwlehnkgfcnsrqlhktivsd
    kgravfnglinvaqhaiktdgqmtnnnllmgklaevdtkpqleiyaddvkcshgatvgri
    ddeqifylrsrginqqdaqqmiiyafaaeltealrdeglkqqvlarigqrlpgg