PDB entry 1vh3

View 1vh3 on RCSB PDB site
Description: Crystal structure of CMP-KDO synthetase
Class: Transferase
Keywords: structural genomics, Transferase
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.256
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-deoxy-manno-octulosonate cytidylyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: KDSB, HI0058
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44490 (1-End)
      • modified residue (28)
      • modified residue (66)
      • modified residue (122)
      • modified residue (167)
    Domains in SCOPe 2.07: d1vh3a_
  • Chain 'B':
    Compound: 3-deoxy-manno-octulosonate cytidylyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: KDSB, HI0058
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44490 (1-End)
      • modified residue (28)
      • modified residue (66)
      • modified residue (122)
      • modified residue (167)
    Domains in SCOPe 2.07: d1vh3b_
  • Chain 'C':
    Compound: 3-deoxy-manno-octulosonate cytidylyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: KDSB, HI0058
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44490 (1-End)
      • modified residue (28)
      • modified residue (66)
      • modified residue (122)
    Domains in SCOPe 2.07: d1vh3c_
  • Heterogens: CMK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vh3A (A:)
    msftviiparfassrlpgkpladikgkpmiqhvfekalqsgasrviiatdnenvadvaks
    fgaevcmtsvnhnsgterlaevveklaipdneiivniqgdeplippvivrqvadnlakfn
    vnmaslavkihdaeelfnpnavkvltdkdgyvlyfsrsvipydrdqfmnlqdvqkvqlsd
    aylrhigiyayragfikqyvqwaptqlenlekleqlrvlyngerihvelakevpavgvdt
    aedlekvrailaangshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh3A (A:)
    sftviiparpmiqhvfekalqsgasrviiatdnenvadvaksfgaevcmtsvnhnsgter
    laevveklaipdneiivniqgdeplippvivrqvadnlakfnvnmaslavkihdaeelfn
    pnavkvltdkdgyvlyfsrsvipydrdqfmnlqdvqkvqlsdaylrhigiyayragfikq
    yvqwaptqlenlekleqlrvlyngerihvel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vh3B (B:)
    msftviiparfassrlpgkpladikgkpmiqhvfekalqsgasrviiatdnenvadvaks
    fgaevcmtsvnhnsgterlaevveklaipdneiivniqgdeplippvivrqvadnlakfn
    vnmaslavkihdaeelfnpnavkvltdkdgyvlyfsrsvipydrdqfmnlqdvqkvqlsd
    aylrhigiyayragfikqyvqwaptqlenlekleqlrvlyngerihvelakevpavgvdt
    aedlekvrailaangshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh3B (B:)
    sftviiparfarlpgkpladikgkpmiqhvfekalqsgasrviiatdnenvadvaksfga
    evcmtsvnhnsgterlaevveklaipdneiivniqgdeplippvivrqvadnlakfnvnm
    aslavkihdaeelfnpnavkvltdkdgyvlyfsrsvipydrdqfmnlqdvqkvqlsdayl
    rhigiyayragfikqyvqwaptqlenlekleqlrvlyngerihvelakevpavgvdtaed
    lekvra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vh3C (C:)
    msftviiparfassrlpgkpladikgkpmiqhvfekalqsgasrviiatdnenvadvaks
    fgaevcmtsvnhnsgterlaevveklaipdneiivniqgdeplippvivrqvadnlakfn
    vnmaslavkihdaeelfnpnavkvltdkdgyvlyfsrsvipydrdqfmnlqdvqkvqlsd
    aylrhigiyayragfikqyvqwaptqlenlekleqlrvlyngerihvelakevpavgvdt
    aedlekvrailaangshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh3C (C:)
    sftviiparfassrlpgkpladikgkpmiqhvfekalqsgasrviiatdnenvadvaksf
    gaevcmtsvnhnsgterlaevveklaipdneiivniqgdeplippvivrqvadnlakfnv
    nmaslavkihdaeelfnpnavkvltdkdgyvlyfsrsvipydrdqflsdaylrhigiyay
    ragfikqyvqwaptqlenlekleqlrvlyngerihvelakevpavgvdtaedlekvra