PDB entry 1vh2

View 1vh2 on RCSB PDB site
Description: Crystal structure of a autoinducer-2 synthesis protein
Class: hydrolase
Keywords: structural genomics, HYDROLASE
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-ribosylhomocysteinase
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: LUXS, DR2387
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vh2a_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vh2A (A:)
    mpdmanvesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtle
    hllagymrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgv
    selecgnyrdhdlaaarqhardvldqglkvqetillergshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh2A (A:)
    vesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtlehllagy
    mrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgvselecg
    nyrdhdlaaarqhardvldqglkvqetiller