PDB entry 1vh1

View 1vh1 on RCSB PDB site
Description: Crystal structure of CMP-KDO synthetase
Class: Transferase
Keywords: structural genomics, Transferase
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.24
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-deoxy-manno-octulosonate cytidylyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: KDSB, B0918
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04951 (1-End)
      • modified residue (28)
      • modified residue (66)
      • modified residue (102)
      • modified residue (122)
      • modified residue (207)
      • modified residue (246)
    Domains in SCOPe 2.07: d1vh1a_
  • Chain 'B':
    Compound: 3-deoxy-manno-octulosonate cytidylyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: KDSB, B0918
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04951 (1-End)
      • modified residue (28)
      • modified residue (66)
      • modified residue (102)
      • modified residue (122)
      • modified residue (207)
      • modified residue (246)
    Domains in SCOPe 2.07: d1vh1b_
  • Chain 'C':
    Compound: 3-deoxy-manno-octulosonate cytidylyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: KDSB, B0918
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04951 (1-End)
      • modified residue (28)
      • modified residue (66)
      • modified residue (102)
      • modified residue (122)
      • modified residue (207)
      • modified residue (246)
    Domains in SCOPe 2.07: d1vh1c_
  • Chain 'D':
    Compound: 3-deoxy-manno-octulosonate cytidylyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: KDSB, B0918
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04951 (1-End)
      • modified residue (28)
      • modified residue (66)
      • modified residue (102)
      • modified residue (122)
      • modified residue (207)
      • modified residue (246)
    Domains in SCOPe 2.07: d1vh1d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vh1A (A:)
    msfvviiparyastrlpgkplvdingkpmivhvleraresgaeriivatdhedvaravea
    aggevcmtradhqsgterlaevvekcafsddtvivnvqgdepmipatiirqvadnlaqrq
    vgmatlavpihnaeeafnpnavkvvldaegyalyfsratipwdrdrfaegletvgdnflr
    hlgiygyragfirryvnwqpsplehiemleqlrvlwygekihvavaqevpgtgvdtpedl
    ervraemrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh1A (A:)
    sfvviiparyastpgkplvdingkpmivhvleraresgaeriivatdhedvaraveaagg
    evcmtrgterlaevvekcafsddtvivnvqgdepmipatiirqvadnlaqrqvgmatlav
    pihnaeeafnpnavkvvldaegyalyfsratipwdrdrfaegletvgdnflrhlgiygyr
    agfirryvnwqpsplehiemleqlrvlwygekihvavaqevpgtgvdtpedlervraem
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vh1B (B:)
    msfvviiparyastrlpgkplvdingkpmivhvleraresgaeriivatdhedvaravea
    aggevcmtradhqsgterlaevvekcafsddtvivnvqgdepmipatiirqvadnlaqrq
    vgmatlavpihnaeeafnpnavkvvldaegyalyfsratipwdrdrfaegletvgdnflr
    hlgiygyragfirryvnwqpsplehiemleqlrvlwygekihvavaqevpgtgvdtpedl
    ervraemrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh1B (B:)
    sfvviiparygkplvdingkpmivhvleraresgaeriivatdhedvaraveaaggevcm
    traterlaevvekcafsddtvivnvqgdepmipatiirqvadnlaqrqvgmatlavpihn
    aeeafnpnavkvvldaegyalyfsratipwdrdrfaegletvgdnflrhlgiygyragfi
    rryvnwqpsplehiemleqlrvlwygekihvavaedlervraem
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vh1C (C:)
    msfvviiparyastrlpgkplvdingkpmivhvleraresgaeriivatdhedvaravea
    aggevcmtradhqsgterlaevvekcafsddtvivnvqgdepmipatiirqvadnlaqrq
    vgmatlavpihnaeeafnpnavkvvldaegyalyfsratipwdrdrfaegletvgdnflr
    hlgiygyragfirryvnwqpsplehiemleqlrvlwygekihvavaqevpgtgvdtpedl
    ervraemrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh1C (C:)
    sfvviiparyastrlpgkplvdingkpmivhvleraresgaeriivatdhedvaraveaa
    ggevcmtqsgterlaevvekcafsddtvivnvqgdepmipatiirqvadnlaqrqvgmat
    lavpihnaeeafnpnavkvvldaegyalyfsratipwdrdrfavgdnflrhlgiygyrag
    firryvnwqpsplehiemleqlrvlwygekihvavaqegvdtpedlervraem
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vh1D (D:)
    msfvviiparyastrlpgkplvdingkpmivhvleraresgaeriivatdhedvaravea
    aggevcmtradhqsgterlaevvekcafsddtvivnvqgdepmipatiirqvadnlaqrq
    vgmatlavpihnaeeafnpnavkvvldaegyalyfsratipwdrdrfaegletvgdnflr
    hlgiygyragfirryvnwqpsplehiemleqlrvlwygekihvavaqevpgtgvdtpedl
    ervraemrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh1D (D:)
    sfvviiparyastrlpgkplvdingkpmivhvleraresgaeriivatdhedvaraveaa
    ggevcmtsgterlaevvekcafsddtvivnvqgdepmipatiirqvadnlaqrqvgmatl
    avpihnaeeafnpnavkvvldaegyalyfsratipwdrdrfaegletvgdnflrhlgiyg
    yragfirryvnwqpsplehiemleqlrvlwygekihvavaqevpgtgvdtpedlervrae
    m