PDB entry 1vh0

View 1vh0 on RCSB PDB site
Description: Crystal structure of a hypothetical protein
Class: Structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-11-03, released 2003-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0247 protein SAV0024/SA0023
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SAV0024, SA0023
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N8 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d1vh0a1, d1vh0a2
  • Chain 'B':
    Compound: Hypothetical UPF0247 protein SAV0024/SA0023
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SAV0024, SA0023
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N8 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d1vh0b1, d1vh0b2
  • Chain 'C':
    Compound: Hypothetical UPF0247 protein SAV0024/SA0023
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SAV0024, SA0023
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N8 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d1vh0c1, d1vh0c2
  • Chain 'D':
    Compound: Hypothetical UPF0247 protein SAV0024/SA0023
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SAV0024, SA0023
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N8 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d1vh0d1, d1vh0d2
  • Chain 'E':
    Compound: Hypothetical UPF0247 protein SAV0024/SA0023
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SAV0024, SA0023
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N8 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d1vh0e1, d1vh0e2
  • Chain 'F':
    Compound: Hypothetical UPF0247 protein SAV0024/SA0023
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SAV0024, SA0023
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N8 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d1vh0f1, d1vh0f2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vh0A (A:)
    mslkitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvkek
    egqrilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvl
    qrsnyalsfskmtfphqmmrvvlieqvyrafkimrgeayhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh0A (A:)
    lkitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvkekeg
    qrilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvlqr
    snyalsfskmtfphqmmrvvlieqvyrafkimrgeay
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vh0B (B:)
    mslkitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvkek
    egqrilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvl
    qrsnyalsfskmtfphqmmrvvlieqvyrafkimrgeayhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh0B (B:)
    lkitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvkekeg
    qrilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvlqr
    snyalsfskmtfphqmmrvvlieqvyrafkimrgeay
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vh0C (C:)
    mslkitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvkek
    egqrilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvl
    qrsnyalsfskmtfphqmmrvvlieqvyrafkimrgeayhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh0C (C:)
    lkitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvkekeg
    qrilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvlqr
    snyalsfskmtfphqmmrvvlieqvyrafkimrgeay
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vh0D (D:)
    mslkitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvkek
    egqrilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvl
    qrsnyalsfskmtfphqmmrvvlieqvyrafkimrgeayhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh0D (D:)
    lkitilavgklkekywkqaiaeyekrlgpytkidiievpdkeieqvkekegqrilakikp
    qstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvlqrsnyalsfsk
    mtfphqmmrvvlieqvyrafkimrgeay
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vh0E (E:)
    mslkitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvkek
    egqrilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvl
    qrsnyalsfskmtfphqmmrvvlieqvyrafkimrgeayhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh0E (E:)
    lkitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvkekeg
    qrilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvlqr
    snyalsfskmtfphqmmrvvlieqvyrafkimrgeay
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vh0F (F:)
    mslkitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvkek
    egqrilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvl
    qrsnyalsfskmtfphqmmrvvlieqvyrafkimrgeayhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh0F (F:)
    lkitilavgklkekywkqaiaeyekrlgpytkidiievpdekapsdkeieqvkekegqri
    lakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvlqrsny
    alsfskmtfphqmmrvvlieqvyrafkimrgeay