PDB entry 1vgz

View 1vgz on RCSB PDB site
Description: Crystal structure of 4-diphosphocytidyl-2C-methyl-D-erythritol synthase
Class: transferase
Keywords: structural genomics, Transferase
Deposited on 2003-11-03, released 2003-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: ygbP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vgza_
  • Chain 'B':
    Compound: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: ygbP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vgzb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vgzA (A:)
    mslkrknialipaagigvrfgadkpkqyveigsktvlehvlgiferheavdltvvvvspe
    dtfadkvqtafpqvrvwknggqtraetvrngvaklletglaaetdnilvhdaarcclpse
    alarlieqagnaaeggilavpvadtlkraesgqisatvdrsglwqaqtpqlfqagllhra
    laaenlggitdeasaveklgvrplliqgdarnlkltqpqdayivrllldaveggshhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgzA (A:)
    lkrknialipaakqyveigsktvlehvlgiferheavdltvvvvspedtfadkvqtafpq
    vrvwknggqtraetvrngvaklletglaaetdnilvhdaarcclpsealarlieqagnaa
    eggilavpvadtlkraesgqisatvdrsglwqaqtpqlfqagllhralaaeitdeasave
    klgvrplliqgdarnlkltqpqdayivrllld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vgzB (B:)
    mslkrknialipaagigvrfgadkpkqyveigsktvlehvlgiferheavdltvvvvspe
    dtfadkvqtafpqvrvwknggqtraetvrngvaklletglaaetdnilvhdaarcclpse
    alarlieqagnaaeggilavpvadtlkraesgqisatvdrsglwqaqtpqlfqagllhra
    laaenlggitdeasaveklgvrplliqgdarnlkltqpqdayivrllldaveggshhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgzB (B:)
    krknialipapkqyveigsktvlehvlgiferheavdltvvvvspedtfadkvqtafpqv
    rvwknggqtraetvrngvaklletglaaetdnilvhdaarcclpsealarlieqagnaae
    ggilavpvadtlkraesgqisatvdrsglwqaqtpqlfqagllhralaaitdeasavekl
    gvrplliqgdarnlkltqpqdayivrllld