PDB entry 1vgy

View 1vgy on RCSB PDB site
Description: Crystal structure of succinyl diaminopimelate desuccinylase
Class: Structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-11-03, released 2003-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: succinyl-diaminopimelate desuccinylase
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: dapE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JYL2 (3-End)
      • engineered (31)
      • engineered (45)
      • variant (49)
      • modified residue (103)
      • modified residue (175)
      • engineered (336)
      • variant (374)
    Domains in SCOPe 2.06: d1vgya1, d1vgya2
  • Chain 'B':
    Compound: succinyl-diaminopimelate desuccinylase
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: dapE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JYL2 (3-End)
      • engineered (31)
      • engineered (45)
      • variant (49)
      • modified residue (103)
      • modified residue (175)
      • engineered (336)
      • variant (374)
    Domains in SCOPe 2.06: d1vgyb1, d1vgyb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vgyA (A:)
    msltetqslelakelisrpsvtpddrdcqklmaerlhkigfaaeemhfgntkniwlrrgt
    kapvvcfaghtdvvptgpvekwdsppfepaerdgrlygrgaadmktsiacfvtacerfva
    khpnhqgsiallitsdeegdaldgttkvvdvlkardelidycivgeptavdklgdmikng
    rrgslsgnltvkgkqghiayphlainpvhtfapalleltqevwdegneyfpptsfqisni
    nggtgatnvipgelnvkfnfrfstesteaglkqrvhaildkhgvqydlqwscsgqpfltq
    agkltdvaraaiaetcgieaelsttggtsdgrfikamaqelielgpsnatihqinenvrl
    ndipklsavyegilvrllagnaveggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgyA (A:)
    tetqslelakelisrpsvtpddrdcqklmaerlhkigfaaeemhfgntkniwlrrgtkap
    vvcfaghtdvvptgpvekwdsppfepaerdgrlygrgaadmktsiacfvtacerfvakhp
    nhqgsiallitsdeegdaldgttkvvdvlkardelidycivgeptavdklgdmikngrrg
    slsgnltvkgkqghiayphlainpvhtfapalleltqevwdegneyfpptsfqisningg
    tgatnvipgelnvkfnfrfstesteaglkqrvhaildkhgvqydlqwscsgqpfltqagk
    ltdvaraaiaetcgieaelsttggtsdgrfikamaqelielgpsnatihqinenvrlndi
    pklsavyegilvrll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vgyB (B:)
    msltetqslelakelisrpsvtpddrdcqklmaerlhkigfaaeemhfgntkniwlrrgt
    kapvvcfaghtdvvptgpvekwdsppfepaerdgrlygrgaadmktsiacfvtacerfva
    khpnhqgsiallitsdeegdaldgttkvvdvlkardelidycivgeptavdklgdmikng
    rrgslsgnltvkgkqghiayphlainpvhtfapalleltqevwdegneyfpptsfqisni
    nggtgatnvipgelnvkfnfrfstesteaglkqrvhaildkhgvqydlqwscsgqpfltq
    agkltdvaraaiaetcgieaelsttggtsdgrfikamaqelielgpsnatihqinenvrl
    ndipklsavyegilvrllagnaveggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgyB (B:)
    tetqslelakelisrpsvtpddrdcqklmaerlhkigfaaeemhfgntkniwlrrgtkap
    vvcfaghtdvvptgpvekwdsppfepaerdgrlygrgaadmktsiacfvtacerfvakhp
    nhqgsiallitsdeegdaldgttkvvdvlkardelidycivgeptavdklgdmikngrrg
    slsgnltvkgkqghiayphlainpvhtfapalleltqevwdegneyfpptsfqisningg
    tgatnvipgelnvkfnfrfstesteaglkqrvhaildkhgvqydlqwscsgqpfltqagk
    ltdvaraaiaetcgieaelsttggtsdgrfikamaqelielgpsnatihqinenvrlndi
    pklsavyegilvrll