PDB entry 1vgy

View 1vgy on RCSB PDB site
Description: crystal structure of succinyl diaminopimelate desuccinylase
Deposited on 2003-11-03, released 2003-11-25
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vgyA (A:)
    msltetqslelakelisrpsvtpddrdcqklmaerlhkigfaaeemhfgntkniwlrrgt
    kapvvcfaghtdvvptgpvekwdsppfepaerdgrlygrgaadmktsiacfvtacerfva
    khpnhqgsiallitsdeegdaldgttkvvdvlkardelidycivgeptavdklgdmikng
    rrgslsgnltvkgkqghiayphlainpvhtfapalleltqevwdegneyfpptsfqisni
    nggtgatnvipgelnvkfnfrfstesteaglkqrvhaildkhgvqydlqwscsgqpfltq
    agkltdvaraaiaetcgieaelsttggtsdgrfikamaqelielgpsnatihqinenvrl
    ndipklsavyegilvrllagnaveggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgyA (A:)
    tetqslelakelisrpsvtpddrdcqklmaerlhkigfaaeemhfgntkniwlrrgtkap
    vvcfaghtdvvptgpvekwdsppfepaerdgrlygrgaadmktsiacfvtacerfvakhp
    nhqgsiallitsdeegdaldgttkvvdvlkardelidycivgeptavdklgdmikngrrg
    slsgnltvkgkqghiayphlainpvhtfapalleltqevwdegneyfpptsfqisningg
    tgatnvipgelnvkfnfrfstesteaglkqrvhaildkhgvqydlqwscsgqpfltqagk
    ltdvaraaiaetcgieaelsttggtsdgrfikamaqelielgpsnatihqinenvrlndi
    pklsavyegilvrll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vgyB (B:)
    msltetqslelakelisrpsvtpddrdcqklmaerlhkigfaaeemhfgntkniwlrrgt
    kapvvcfaghtdvvptgpvekwdsppfepaerdgrlygrgaadmktsiacfvtacerfva
    khpnhqgsiallitsdeegdaldgttkvvdvlkardelidycivgeptavdklgdmikng
    rrgslsgnltvkgkqghiayphlainpvhtfapalleltqevwdegneyfpptsfqisni
    nggtgatnvipgelnvkfnfrfstesteaglkqrvhaildkhgvqydlqwscsgqpfltq
    agkltdvaraaiaetcgieaelsttggtsdgrfikamaqelielgpsnatihqinenvrl
    ndipklsavyegilvrllagnaveggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgyB (B:)
    tetqslelakelisrpsvtpddrdcqklmaerlhkigfaaeemhfgntkniwlrrgtkap
    vvcfaghtdvvptgpvekwdsppfepaerdgrlygrgaadmktsiacfvtacerfvakhp
    nhqgsiallitsdeegdaldgttkvvdvlkardelidycivgeptavdklgdmikngrrg
    slsgnltvkgkqghiayphlainpvhtfapalleltqevwdegneyfpptsfqisningg
    tgatnvipgelnvkfnfrfstesteaglkqrvhaildkhgvqydlqwscsgqpfltqagk
    ltdvaraaiaetcgieaelsttggtsdgrfikamaqelielgpsnatihqinenvrlndi
    pklsavyegilvrll