PDB entry 1vgw

View 1vgw on RCSB PDB site
Description: Crystal structure of 4-diphosphocytidyl-2C-methyl-D-erythritol synthase
Class: transferase
Keywords: structural genomics, TRANSFERASE
Deposited on 2003-11-03, released 2003-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.26
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: ygbP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vgwa_
  • Chain 'B':
    Compound: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: ygbP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vgwb_
  • Chain 'C':
    Compound: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: ygbP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vgwc_
  • Chain 'D':
    Compound: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: ygbP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vgwd_
  • Chain 'E':
    Compound: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: ygbP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vgwe_
  • Chain 'F':
    Compound: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: ygbP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vgwf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vgwA (A:)
    mslkrknialipaagigvrfgadkpkqyveigsktvlehvlgiferheavdltvvvvspe
    dtfadkvqtafpqvrvwknggqtraetvrngvaklletglaaetdnilvhdaarcclpse
    alarlieqagnaaeggilavpvadtlkraesgqisatvdrsglwqaqtpqlfqagllhra
    laaenlggitdeasaveklgvrplliqgdarnlkltqpqdayivrllldav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgwA (A:)
    krknialipaapkqyveigsktvlehvlgiferheavdltvvvvspedtfadkvqtafpq
    vrvwknggqtraetvrngvaklletglaaetdnilvhdaarcclpsealarlieqagnaa
    eggilavpvadtlkraesgqisatvdrsglwqaqtpqlfqagllhralaagitdeasave
    klgvrplliqgdarnlkltqpqdayivrllld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vgwB (B:)
    mslkrknialipaagigvrfgadkpkqyveigsktvlehvlgiferheavdltvvvvspe
    dtfadkvqtafpqvrvwknggqtraetvrngvaklletglaaetdnilvhdaarcclpse
    alarlieqagnaaeggilavpvadtlkraesgqisatvdrsglwqaqtpqlfqagllhra
    laaenlggitdeasaveklgvrplliqgdarnlkltqpqdayivrllldav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgwB (B:)
    lkrknialipaakqyveigsktvlehvlgiferheavdltvvvvspedtfadkvqtafpq
    vrvwknggqtraetvrngvaklletglaaetdnilvhdaarcclpsealarlieqagnaa
    eggilavpvadtlkraesgqisatvdrsglwqaqtpqlfqagllhralaalggitdeasa
    veklgvrplliqgdarnlkltqpqdayivrllld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vgwC (C:)
    mslkrknialipaagigvrfgadkpkqyveigsktvlehvlgiferheavdltvvvvspe
    dtfadkvqtafpqvrvwknggqtraetvrngvaklletglaaetdnilvhdaarcclpse
    alarlieqagnaaeggilavpvadtlkraesgqisatvdrsglwqaqtpqlfqagllhra
    laaenlggitdeasaveklgvrplliqgdarnlkltqpqdayivrllldav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgwC (C:)
    slkrknialipaagpkqyveigsktvlehvlgiferheavdltvvvvspedtfadkvqta
    fpqvrvwknggqtraetvrngvaklletglaaetdnilvhdaarcclpsealarlieqag
    naaeggilavpvadtlkraesgqisatvdrsglwqaqtpqlfqagllhralaaitdeasa
    veklgvrplliqgdarnlkltqpqdayivrllld
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vgwD (D:)
    mslkrknialipaagigvrfgadkpkqyveigsktvlehvlgiferheavdltvvvvspe
    dtfadkvqtafpqvrvwknggqtraetvrngvaklletglaaetdnilvhdaarcclpse
    alarlieqagnaaeggilavpvadtlkraesgqisatvdrsglwqaqtpqlfqagllhra
    laaenlggitdeasaveklgvrplliqgdarnlkltqpqdayivrllldav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgwD (D:)
    rknialipaapkqyveigsktvlehvlgiferheavdltvvvvspedtfadkvqtafpqv
    rvwknggqtraetvrngvaklletglaaetdnilvhdaarcclpsealarlieqagnaae
    ggilavpvadtlkraesgqisatvdrsglwqaqtpqlfqagllhralaagitdeasavek
    lgvrplliqgdarnlkltqpqdayivrllld
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vgwE (E:)
    mslkrknialipaagigvrfgadkpkqyveigsktvlehvlgiferheavdltvvvvspe
    dtfadkvqtafpqvrvwknggqtraetvrngvaklletglaaetdnilvhdaarcclpse
    alarlieqagnaaeggilavpvadtlkraesgqisatvdrsglwqaqtpqlfqagllhra
    laaenlggitdeasaveklgvrplliqgdarnlkltqpqdayivrllldav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgwE (E:)
    slkrknialipaagpkqyveigsktvlehvlgiferheavdltvvvvspedtfadkvqta
    fpqvrvwknggqtraetvrngvaklletglaaetdnilvhdaarcclpsealarlieqag
    naaeggilavpvadtlkraesgqisatvdrsglwqaqtpqlfqagllhralaitdeasav
    eklgvrplliqgdarnlkltqpqdayivrllld
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vgwF (F:)
    mslkrknialipaagigvrfgadkpkqyveigsktvlehvlgiferheavdltvvvvspe
    dtfadkvqtafpqvrvwknggqtraetvrngvaklletglaaetdnilvhdaarcclpse
    alarlieqagnaaeggilavpvadtlkraesgqisatvdrsglwqaqtpqlfqagllhra
    laaenlggitdeasaveklgvrplliqgdarnlkltqpqdayivrllldav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgwF (F:)
    krknialipaaqyveigsktvlehvlgiferheavdltvvvvspedtfadkvqtafpqvr
    vwknggqtraetvrngvaklletglaaetdnilvhdaarcclpsealarlieqagnaaeg
    gilavpvadtlkraesgqisatvdrsglwqaqtpqlfqagllhralagitdeasaveklg
    vrplliqgdarnlkltqpqdayivrllld