PDB entry 1vgv

View 1vgv on RCSB PDB site
Description: Crystal structure of UDP-N-acetylglucosamine_2 epimerase
Class: isomerase
Keywords: structural genomics, Isomerase
Deposited on 2003-11-03, released 2003-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylglucosamine 2-epimerase
    Species: Escherichia coli [TaxId:562]
    Gene: WECB, RFFE, NFRC, B3786
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27828 (1-375)
      • cloning artifact (0)
      • modified residue (15)
      • modified residue (41)
      • modified residue (60)
      • modified residue (142)
      • modified residue (184)
      • modified residue (206)
      • modified residue (279)
      • modified residue (306)
      • modified residue (348)
    Domains in SCOPe 2.07: d1vgva1, d1vgva2
  • Chain 'B':
    Compound: udp-n-acetylglucosamine 2-epimerase
    Species: Escherichia coli [TaxId:562]
    Gene: WECB, RFFE, NFRC, B3786
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27828 (1-375)
      • cloning artifact (0)
      • modified residue (15)
      • modified residue (41)
      • modified residue (142)
      • modified residue (184)
      • modified residue (206)
      • modified residue (279)
      • modified residue (306)
      • modified residue (348)
    Domains in SCOPe 2.07: d1vgvb1, d1vgvb2
  • Chain 'C':
    Compound: udp-n-acetylglucosamine 2-epimerase
    Species: Escherichia coli [TaxId:562]
    Gene: WECB, RFFE, NFRC, B3786
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27828 (1-End)
      • cloning artifact (0)
      • modified residue (15)
      • modified residue (41)
      • modified residue (142)
      • modified residue (184)
      • modified residue (206)
      • modified residue (279)
      • modified residue (306)
      • modified residue (348)
    Domains in SCOPe 2.07: d1vgvc1, d1vgvc2
  • Chain 'D':
    Compound: udp-n-acetylglucosamine 2-epimerase
    Species: Escherichia coli [TaxId:562]
    Gene: WECB, RFFE, NFRC, B3786
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27828 (1-End)
      • cloning artifact (0)
      • modified residue (15)
      • modified residue (41)
      • modified residue (60)
      • modified residue (142)
      • modified residue (184)
      • modified residue (206)
      • modified residue (279)
      • modified residue (306)
      • modified residue (348)
    Domains in SCOPe 2.07: d1vgvd1, d1vgvd2
  • Heterogens: UD1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vgvA (A:)
    mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
    mqpgqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveagl
    rtgdlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwv
    rdqvmssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiq
    ivypvhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapsl
    gkpvlvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgq
    acsrilealknnrislgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgvA (A:)
    mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
    mqpgqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveagl
    rtgdlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwv
    rdqvmssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiq
    ivypvhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapsl
    gkpvlvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgq
    acsrilealknnrisl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vgvB (B:)
    mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
    mqpgqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveagl
    rtgdlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwv
    rdqvmssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiq
    ivypvhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapsl
    gkpvlvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgq
    acsrilealknnrislgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgvB (B:)
    mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
    qglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveaglrtgd
    lyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwvrdqv
    mssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiqivyp
    vhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapslgkpv
    lvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgqacsr
    ilealknnrisl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vgvC (C:)
    mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
    mqpgqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveagl
    rtgdlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwv
    rdqvmssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiq
    ivypvhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapsl
    gkpvlvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgq
    acsrilealknnrislgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgvC (C:)
    mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
    gqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveaglrtg
    dlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwvrdq
    vmssdklrselaanypfidpdkkmilvtghrfgrgfeeichaladiatthqdiqivypvh
    lnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapslgkpvlv
    mrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgqacsril
    ealknnr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vgvD (D:)
    mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
    mqpgqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveagl
    rtgdlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwv
    rdqvmssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiq
    ivypvhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapsl
    gkpvlvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgq
    acsrilealknnrislgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgvD (D:)
    mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
    mqpgqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveagl
    rtgdlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwv
    rdqvmssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiq
    ivypvhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapsl
    gkpvlvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgq
    acsrilealknnri