PDB entry 1vgt

View 1vgt on RCSB PDB site
Description: Crystal structure of 4-diphosphocytidyl-2C-methyl-D-erythritol synthase
Class: transferase
Keywords: structural genomics, Transferase
Deposited on 2003-11-03, released 2003-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: ISPD, B2747
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vgta_
  • Chain 'B':
    Compound: 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: ISPD, B2747
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vgtb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vgtA (A:)
    mslatthldvcavvpaagfgrrmqtecpkqylsignqtilehsvhallahprvkrvviai
    spgdsrfaqlplanhpqitvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddla
    rllalsetsrtggilaapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcl
    tralnegatitdeasaleycgfhpqlvegradnikvtrpedlalaefyltrtihqent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgtA (A:)
    ldvcavvpaapkqylsignqtilehsvhallahprvkrvviaissrfaqlplanhpqitv
    vdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarllalsetsrtggilaapvr
    dtmkraepgknaiahtvdrnglwhaltpqffprellhdcltralnegatitdeasaleyc
    gfhpqlvegradnikvtedlalaefyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vgtB (B:)
    mslatthldvcavvpaagfgrrmqtecpkqylsignqtilehsvhallahprvkrvviai
    spgdsrfaqlplanhpqitvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddla
    rllalsetsrtggilaapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcl
    tralnegatitdeasaleycgfhpqlvegradnikvtrpedlalaefyltrtihqent
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgtB (B:)
    ldvcavvpaagfgpkqylsignqtilehsvhallahprvkrvviaispgdsrfaqlplan
    hpqitvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarllalsetsrtggi
    laapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltralnegatitdea
    saleycgfhpqlvegradnikvtrpedlalaefyltr