PDB entry 1vgs

View 1vgs on RCSB PDB site
Description: Crystal Structure of Peroxiredoxin from an Aerobic Hyperthermophilic Crenarchaeon Aeropyrum pernix K1
Class: oxygen storage/transport
Keywords: thioredoxin peroxidase, thioredoxin fold, reactive oxigen scavenging system
Deposited on 2004-04-30, released 2004-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-06-14, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.179
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxiredoxin
    Species: Aeropyrum pernix
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y9L0
      • modified residue (14)
      • modified residue (139)
      • modified residue (144)
      • modified residue (199)
    Domains in SCOPe 2.07: d1vgsa_
  • Chain 'B':
    Compound: peroxiredoxin
    Species: Aeropyrum pernix
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y9L0
      • modified residue (14)
      • modified residue (139)
      • modified residue (144)
      • modified residue (199)
    Domains in SCOPe 2.07: d1vgsb_
  • Chain 'C':
    Compound: peroxiredoxin
    Species: Aeropyrum pernix
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y9L0
      • modified residue (14)
      • modified residue (139)
      • modified residue (144)
      • modified residue (199)
    Domains in SCOPe 2.07: d1vgsc_
  • Chain 'D':
    Compound: peroxiredoxin
    Species: Aeropyrum pernix
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y9L0
      • modified residue (14)
      • modified residue (139)
      • modified residue (144)
      • modified residue (199)
    Domains in SCOPe 2.07: d1vgsd_
  • Chain 'E':
    Compound: peroxiredoxin
    Species: Aeropyrum pernix
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y9L0
      • modified residue (14)
      • modified residue (139)
      • modified residue (144)
      • modified residue (199)
  • Chain 'F':
    Compound: peroxiredoxin
    Species: Aeropyrum pernix
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y9L0
      • modified residue (14)
      • modified residue (139)
      • modified residue (144)
      • modified residue (199)
    Domains in SCOPe 2.07: d1vgsf_
  • Chain 'G':
    Compound: peroxiredoxin
    Species: Aeropyrum pernix
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y9L0
      • modified residue (14)
      • modified residue (139)
      • modified residue (144)
      • modified residue (199)
    Domains in SCOPe 2.07: d1vgsg_
  • Chain 'H':
    Compound: peroxiredoxin
    Species: Aeropyrum pernix
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y9L0
      • modified residue (14)
      • modified residue (139)
      • modified residue (144)
      • modified residue (199)
    Domains in SCOPe 2.07: d1vgsh_
  • Chain 'I':
    Compound: peroxiredoxin
    Species: Aeropyrum pernix
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y9L0
      • modified residue (14)
      • modified residue (139)
      • modified residue (144)
      • modified residue (199)
    Domains in SCOPe 2.07: d1vgsi_
  • Chain 'J':
    Compound: peroxiredoxin
    Species: Aeropyrum pernix
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y9L0
      • modified residue (14)
      • modified residue (139)
      • modified residue (144)
      • modified residue (199)
    Domains in SCOPe 2.07: d1vgsj_
  • Heterogens: MES, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vgsA (A:)
    mpgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarr
    yedfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaes
    athtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnnei
    igeglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakl
    lyeearthlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgsA (A:)
    pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry
    edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa
    thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii
    geglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakll
    y
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vgsB (B:)
    mpgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarr
    yedfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaes
    athtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnnei
    igeglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakl
    lyeearthlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgsB (B:)
    pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry
    edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa
    thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii
    geglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakll
    y
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vgsC (C:)
    mpgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarr
    yedfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaes
    athtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnnei
    igeglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakl
    lyeearthlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgsC (C:)
    pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry
    edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa
    thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii
    geglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakll
    y
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vgsD (D:)
    mpgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarr
    yedfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaes
    athtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnnei
    igeglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakl
    lyeearthlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgsD (D:)
    pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry
    edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa
    thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii
    geglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakll
    ye
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vgsF (F:)
    mpgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarr
    yedfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaes
    athtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnnei
    igeglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakl
    lyeearthlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgsF (F:)
    pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry
    edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa
    thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii
    geglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakll
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1vgsG (G:)
    mpgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarr
    yedfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaes
    athtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnnei
    igeglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakl
    lyeearthlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgsG (G:)
    pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry
    edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa
    thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii
    geglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakll
    ye
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1vgsH (H:)
    mpgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarr
    yedfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaes
    athtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnnei
    igeglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakl
    lyeearthlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgsH (H:)
    pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry
    edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa
    thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii
    geglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakll
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1vgsI (I:)
    mpgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarr
    yedfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaes
    athtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnnei
    igeglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakl
    lyeearthlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgsI (I:)
    pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry
    edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa
    thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii
    geglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakll
    y
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1vgsJ (J:)
    mpgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarr
    yedfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaes
    athtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnnei
    igeglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakl
    lyeearthlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vgsJ (J:)
    pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry
    edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa
    thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii
    geglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakll