PDB entry 1vgp

View 1vgp on RCSB PDB site
Description: Crystal Structure of an Isozyme of Citrate Synthase from Sulfolbus tokodaii strain7
Class: transferase
Keywords: Open Form, TRANSFERASE
Deposited on 2004-04-28, released 2005-06-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.217
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 373aa long hypothetical citrate synthase
    Species: Sulfolobus tokodaii [TaxId:111955]
    Gene: strain7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vgpa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vgpA (A:)
    meikkgledvyvketeityidgelgrlyyrgysiydlaefsnfeevsylilygklpnree
    lnwfqeklreerylpdfiikflrevrkdaqpmdilrtavsllgiedskndertdikgikl
    iskfptivanyarlrkgldiiepdpklshsenflymlygdrpneikskamdvtlilhidh
    emnastfaslvvastfsdlyssivagisalkgplhgganyealkmfkeigspekvndyil
    nrlsnkqrimgfghrvyktydprarilkqyakllaekeggeiytlyqiaekveeigikyl
    gpkgiypnvdffssivfyslgfepdffpavfasarvvgwvahimeyikdnkiirpkayyk
    geigkkyipidsr